KEGG   Synechocystis sp. PCC 6803: slr0546Help
Entry
slr0546           CDS       T00004                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
syn01130  Biosynthesis of antibiotics
syn01230  Biosynthesis of amino acids
Module
syn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    slr0546 (trpC)
Enzymes [BR:syn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     slr0546 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth ThiG
Motif
Other DBs
NCBI-ProteinID: BAA10863
CyanoBase: slr0546
CYORF: slr0546
UniProt: Q55508
Position
3240181..3241068
Genome map
AA seq 295 aa AA seqDB search
MEIRRRPPNPPIKVDILQYQIKHPEAAPRHILEEIVWHKEKEVAQRRELVPLVKLQSLVK
DMTPPLDFVGALRQSPRQPALIAEVKKASPSKGIIRADFDPVAIAKAYEAGGANCLSVLT
DEKFFQGSFENLQLVRSAVQLPLLCKEFIIYPYQIYLARSRGADAVLLIAAILSDKDLRY
FLKIIEGLGMAALVEVHTLEEMDRVLALDGVQLIGVNNRNLQTFTVDLQTTEDLFAQRRE
QLTQGDITLVSESGIYELADLQRLQQAGARAVLVGESLVKQPDPQQAIAALYGEV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcgccgccggcctcctaacccccccatcaaagttgacattcttcagtatcaa
attaagcatccagaagcggctccccgtcacattctggaggaaattgtttggcataaggaa
aaggaagtggcccaacggcgagaattagtccccctggtcaaactccaaagtttagtcaag
gacatgactcccccattggattttgtgggggcattgcgccagagtccccggcaaccggcc
ttaattgctgaagtgaaaaaggcttcccctagtaagggcattattcgggcggattttgac
ccagtggcgatcgccaaggcctatgaagcgggaggggctaactgtttatcggtgttgacg
gacgagaaatttttccagggtagttttgaaaatttgcaactggtacgctcagcggtgcaa
ttacccttgctgtgcaaggaatttattatttacccctatcaaatctatctagcccggagt
cggggggccgatgcggtgctgttaattgccgctatcctcagcgataaggatttgcgttat
ttcctcaaaattattgaaggtttgggcatggcggcgttggtggaagtccataccctggag
gaaatggaccgggttttggctttggacggggtgcaactaatcggagttaataaccgtaat
ttgcaaaccttcaccgttgatctgcaaaccacagaggatctttttgcccaacgacgggag
caattaacccaaggggacattactttagtgagcgaatccggcatttatgaattggctgat
ttgcaaagattacagcaggctggggcccgggccgttttagtcggcgaatccctggtcaaa
caaccagatccccaacaggcgatcgccgctttatacggtgaagtttaa

DBGET integrated database retrieval system