KEGG   Synechocystis sp. PCC 6803: slr0573
Entry
slr0573           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Other DBs
NCBI-ProteinID: BAA10493
CyanoBase: slr0573
CYORF: slr0573
UniProt: Q55402
Position
2816517..2816960
AA seq 147 aa
MIFMKYKAEQFISSSEFSPSFAKLSEHGKNSLSCKIVRNYYVMASTNLTSIRESLRRCRD
ESGQPLSLSPSELKPSSYRLEFELVALIASNLTQMPDLENFIKDDKETTNEDKLILLTAY
QGFKNKVDGLFKLFGWPCFGFKQEKET
NT seq 444 nt   +upstreamnt  +downstreamnt
atgatttttatgaaatacaaagctgaacaatttatcagctcttctgaatttagtcctagt
ttcgccaagctttcagaacacggcaaaaactctttgtcatgcaaaatagtcagaaattac
tatgtgatggcttctacaaacttaacttctattcgtgagtctcttaggagatgtcgcgat
gagagtggacagccacttagcttaagccctagcgaattaaaaccatcaagttatcggctg
gagtttgaactagtagcactaattgcttcaaatttgacacagatgccagatttagagaat
tttatcaaagatgataaagaaactactaatgaagataaattaattttgttgactgcttat
caaggtttcaaaaataaagttgatggattgtttaaattatttggttggccatgctttgga
tttaaacaagaaaaagaaacttaa

DBGET integrated database retrieval system