KEGG   Synechocystis sp. PCC 6803: slr0574
Entry
slr0574           CDS       T00004                                 

Gene name
cyp
Definition
(GenBank) cytochrome P450
  KO
K24392  retinoid hydroxylase
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:syn00199]
    slr0574 (cyp)
Cytochrome P450 [BR:syn00199]
 Cytochrome P450, bacteria type
  CYP120 family
   slr0574 (cyp)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: BAA10496
CyanoBase: slr0574
CYORF: slr0574
UniProt: Q59990
Structure
PDB: 
2VE3 2VE4

Position
2817862..2819196
AA seq 444 aa
MITSPTNLNSLPIPPGDFGLPWLGETLNFLNDGDFGKKRQQQFGPIFKTRLFGKNVIFIS
GALANRFLFTKEQETFQATWPLSTRILLGPNALATQMGEIHRSRRKILYQAFLPRTLDSY
LPKMDGIVQGYLEQWGKANEVIWYPQLRRMTFDVAATLFMGEKVSQNPQLFPWFETYIQG
LFSLPIPLPNTLFGKSQRARALLLAELEKIIKARQQQPPSEEDALGILLAARDDNNQPLS
LPELKDQILLLLFAGHETLTSALSSFCLLLGQHSDIRERVRQEQNKLQLSQELTAETLKK
MPYLDQVLQEVLRLIPPVGGGFRELIQDCQFQGFHFPKGWLVSYQISQTHADPDLYPDPE
KFDPERFTPDGSATHNPPFAHVPFGGGLRECLGKEFARLEMKLFATRLIQQFDWTLLPGQ
NLELVVTPSPRPKDNLRVKLHSLM
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgataacttctcctacaaatttaaattctttacctattccccccggtgactttggttta
ccgtggttaggagaaactctcaattttcttaatgatggggacttcggtaaaaagcggcag
cagcaatttggcccaatttttaaaacccgtttatttggcaaaaatgtcatttttatttct
ggggcattagcgaatagatttttattcaccaaggagcaggaaacttttcaggcaacttgg
cccctcagcaccagaattttgttaggacctaatgcgttagcgactcaaatgggagaaata
catcgctcgcgccgtaaaattctataccaagcttttttacccaggacattggacagttat
ctcccaaaaatggatggcattgttcagggatatttggagcaatggggtaaagccaatgaa
gtgatttggtatccccaattaagacgaatgacttttgatgtggcggcaacgttgttcatg
ggggaaaaagtaagtcaaaatcctcaattatttccctggtttgaaacttatattcaaggg
ctatttagtctgccaattcctttacctaataccctatttggtaaatcccaacgagcaagg
gctttgttattggctgagcttgaaaaaattattaaagctcgacaacagcaaccccccagt
gaagaagatgcattgggcatattattggccgcccgagatgataataaccaaccgttatct
ttgccggagctgaaggatcaaattttattgctattgtttgccggacatgaaactttaact
tccgcattatcttctttttgtctattgttgggacaacattctgacattcgagaaagggtc
agacaggaacagaacaaattgcagttaagccaagagctgacggcagaaactcttaaaaaa
atgccctatctagaccaagtgttacaagaagtattgcggttaattcctcctgtgggcggt
ggttttcgagaattaatccaagattgtcaatttcagggttttcattttcccaaaggctgg
ttagtttcttatcaaattagccaaacccacgccgatcctgatttatatcctgacccagaa
aagtttgatccagaacggtttactcctgatggtagtgcaactcataatcctccctttgcc
catgttccctttggcggtggcttacgggaatgtttaggtaaggaatttgctcggctggaa
atgaaattatttgccacccgattaatccaacaatttgattggacattgttaccggggcaa
aatttagagttggttgttacccctagtccccggcccaaagataatttgcgagtaaagcta
cattcactcatgtaa

DBGET integrated database retrieval system