KEGG   Synechocystis sp. PCC 6803: slr0575
Entry
slr0575           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: DUF2854
Other DBs
NCBI-ProteinID: BAA10497
CyanoBase: slr0575
CYORF: slr0575
UniProt: Q55403
Position
2819323..2819877
AA seq 184 aa
MLPKISLAAVGLTVGGILTITGFVAYALDYATLNLAGFFYGIPLVLGGLALKAAELKPIP
FSQPTSEKIIALRNQLATPTQNQIRKDVTRYRYGQEAHLDESLERLGLSPTDEERPVLTS
LLEQDWEGKYVLTLTFTSPFISLETWQEKQEKIAKFFGPDLEVTVAEPEEKVVTVNLISQ
LALP
NT seq 555 nt   +upstreamnt  +downstreamnt
atgcttcctaaaatttctttggccgcagtggggttaacggtggggggaatcctcaccatt
acaggctttgtggcctacgccctcgactatgccaccctcaatctggctggctttttctat
ggcattcccttagtgttagggggcttggcccttaaggcggcggagttgaaacctattcca
tttagtcaaccgacctcagaaaaaattatcgccctgcgaaaccaactggccacccccacc
caaaatcaaattcgcaaagatgtgacccgttaccgttacggccaggaagcccatctggac
gaatccctagagcgcctaggtttgagtcccacggatgaagaaagaccagtactcactagt
cttttggaacaggattgggagggaaaatacgtgcttaccctaacctttacctcccccttc
atcagcctggaaacttggcaggaaaagcaggaaaaaattgccaaattcttcggcccagac
ctggaagttaccgtcgctgagccggaagaaaaagtggtgacagtgaatctaatttcccaa
ttagccctcccgtaa

DBGET integrated database retrieval system