KEGG   Synechocystis sp. PCC 6803: slr0580
Entry
slr0580           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Met_gamma_lyase Cys_Met_Meta_PP Aminotran_5 Aminotran_1_2
Other DBs
NCBI-ProteinID: BAA10501
CyanoBase: slr0580
CYORF: slr0580
UniProt: Q55407
Position
2823646..2824893
AA seq 415 aa
MKYSSFLKQAEENLVPIFSEIDAKVKENLYKVIEAFRHHRVGVQHFAGVSGYGHDDLGRD
TLDGVFAQVMGAESAAVRVQFVSGTHAIACALYGILRPGDELLSAVGSPYDTLEEVIGLR
GSCQGSLADFNISYRQLPLTAAGTVDWQGLETAVRPETRLVLIQRSCGYSWRPSLAIADI
ARIIEIVKAQNPRTLCFVDNCYGEFIETVEPTAIGVDLMAGSLIKNPGGTIVTAGGYLAG
KEEWVEAGAYRLTAPGIGREGGATFDQNRLLFQGLFLAPQMVGEAMKCNHLLAHVFDQLG
YPVNPAPLSPRRDVIQAIQLGSPEKLLAFCRALQGASPISSYLQPVPAAMPGYASEVVMA
GGTFIDGSTSELSADGPLREPYTVFCQGGTHWTHMAIALEEILAAFEELEDGKKA
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgaaatattccagcttccttaaacaagcagaagaaaacctagtcccaatcttttcggaa
atcgacgcaaaggtcaaggaaaatctgtacaaagtcatagaggcatttcggcaccatcgg
gtaggggtacagcacttcgccggggtgagtggttatggccatgatgacctaggcagagat
actctggacggggtttttgctcaggtgatgggggcagagtcggccgctgtacgggtacag
tttgtgtccggaacccatgcgatcgcctgtgcgttgtacggcattttgcgaccgggggat
gaactactgtcggcggtgggctctccctacgacaccctcgaagaagtgattggtcttagg
ggaagttgtcaaggctccctcgctgactttaacatttcttatcgtcaattgcccctcacg
gcggccggcacggtggattggcaagggctagaaactgcagtgcgtccggaaactcgctta
gttttaatccaacgttcctgtggttacagttggcgccccagtttggcgatcgccgacatt
gccagaattatcgaaattgttaaagcccaaaatcctcgcaccctttgttttgtggacaat
tgctacggggaattcattgagacagtggaaccgacggcgatcggagtggatctgatggct
gggtctttgattaaaaatcctgggggcaccattgttacggcagggggttacctagccggg
aaagaggaatgggtggaagcgggggcctatagattgactgccccaggcattggccgggaa
gggggagccacttttgaccaaaatcgtctgttattccaaggcctcttccttgccccccaa
atggtgggggaagcgatgaaatgtaaccatctgctggcccatgtgtttgaccaattgggt
tacccggttaatcctgcgcccctatctccccgccgggatgtgatccaagccattcagttg
ggcagtccagaaaaattattggctttttgccgggctctacaaggagcttcccccattagt
tcctatcttcaacccgtacccgccgctatgcctggttacgccagtgaagtggtgatggct
gggggcacatttattgacggcagtacttccgagttgtccgccgacggaccattgcgggaa
ccctacaccgttttttgccaaggaggcacccactggacccatatggcgatcgccttggag
gaaattttggccgcctttgaggagttggaggacgggaaaaaagcctag

DBGET integrated database retrieval system