KEGG   Synechocystis sp. PCC 6803: slr0581
Entry
slr0581           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: MliC Ribosomal_S4e
Other DBs
NCBI-ProteinID: BAA10502
CyanoBase: slr0581
CYORF: slr0581
UniProt: Q55408
Position
2825023..2825355
AA seq 110 aa
MKNSYSALWGRPAKVVLVALILGGLGLAIPSYAQETQTYYCSPTETLTIKMVEGSAIQVT
LPDGRTVVLPQAESASGNKYSNGFITVWSKGNTALVEEGGNVKWQDCVKI
NT seq 333 nt   +upstreamnt  +downstreamnt
atgaaaaattcctattccgctctctggggtcgcccagctaaagttgtcctagtggcccta
attcttggtggcttgggtttagcgatacctagctatgcccaggagacccaaacttactac
tgctccccaaccgaaacattgacaattaaaatggtggaaggatctgccattcaggttacc
ctgccggatggtcgcacagtggttttaccccaagcggaatcggcctctgggaataaatac
agcaatggtttcatcaccgtttggtccaagggcaacactgccttggtggaagagggcggc
aacgttaaatggcaggattgcgtcaaaatttga

DBGET integrated database retrieval system