KEGG   Synechocystis sp. PCC 6803: slr0582
Entry
slr0582           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: RBP_receptor ABC2_membrane_2
Other DBs
NCBI-ProteinID: BAA10503
CyanoBase: slr0582
CYORF: slr0582
UniProt: Q55409
Position
2825331..2825711
AA seq 126 aa
MAGLRQNLIMFIPSEDINAMVTTSTDQTRRSPTFLLVTLLSLLTAALVFFPVLAQAGEEE
NPNNPMGYEDADRKDYENMNQENYQDLTDEKSVDDNSLDYEQDDQYENDNQYEYENQDDV
KYRNMN
NT seq 381 nt   +upstreamnt  +downstreamnt
atggcaggattgcgtcaaaatttgatcatgttcatcccttcagaggacattaacgccatg
gttactacttccaccgatcaaacccggcgatcgcctacttttttgttggtaactttactg
agtttgttaactgcggcgttggtgttctttcccgtgctggcccaggcgggagaagaggaa
aatcccaataatcccatgggttacgaagatgcggaccggaaggattacgaaaatatgaat
caggaaaattatcaggatttaactgacgaaaaatccgtcgatgataatagcttagattac
gaacaagacgatcagtatgagaatgacaaccagtatgaatatgaaaatcaagatgatgta
aagtaccgcaatatgaactaa

DBGET integrated database retrieval system