KEGG   Synechocystis sp. PCC 6803: slr0583Help
Entry
slr0583           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD KR Polysacc_synt_2 NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: BAA10506
CyanoBase: slr0583
CYORF: slr0583
UniProt: Q55412
Position
2828140..2829072
Genome map
AA seq 310 aa AA seqDB search
MKILVTGGTGFLGTTLCNQLEAQGHELTKINSRNCDLTQPDSLHQFTKGSFDQIYHLAAW
TQAGDFCLSHPGEQWLINQKLNTNVLDWWHSQQPQAKLIFMGTSCAYDPNLPLEEEYYLT
GLPIDSLFTYAMTKRMLYAGALALQKQYGLKYLCLVPSTLYGPGYHTDGRQMHFIFDLIR
KIIRGKLYGETVTLWGDGYQRRELVFVEDFARIALELAAMVDNDLVNIGAGEEFTIRRFA
ELICQEVDYDFNLIEFDTSRYVGAKSKCLGVKKLHGLMPDLQLTSLDQGLAKTIKWFWSE
QEKLVPASVS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttggtcaccggcggcacgggctttttaggcacaaccctctgcaatcaacta
gaggcccagggtcatgagctaaccaaaatcaattcccgtaactgtgacctgacccaaccg
gattccctacatcagtttaccaagggcagttttgaccaaatttatcacctggctgcttgg
acccaagcgggggatttttgtttgtcccatccgggggaacagtggctgatcaaccaaaaa
ttaaacactaacgttctagattggtggcatagtcaacaaccccaggcgaagttgattttt
atgggcactagttgcgcctatgatcctaatttgcccttggaggaggaatattacctcact
ggtttacccattgatagtttgttcacctacgccatgaccaaaaggatgctttatgcgggg
gcgttggcattgcaaaaacagtatgggctcaaatatctctgcttagtaccttctacccta
tacggccccggataccataccgatgggcggcagatgcattttatttttgacctgattcgc
aaaattattcggggtaagctctacggcgaaacggttactctctggggggacggttatcag
cggcgggaattggtctttgtagaggattttgcccgcattgccctggaactggcggccatg
gtggataacgatttagtcaatattggcgcgggggaagaatttaccattcgtcgctttgcg
gaattaatttgccaggaagtggactacgactttaacctgattgaattcgataccagccgt
tacgtgggggccaaatcaaaatgcttgggggtgaaaaaactccatggcctaatgccggat
ttacaactgaccagtttggatcagggtttggccaaaaccattaagtggttctggagcgaa
caggaaaagttggtgcctgcttctgtatcctga

DBGET integrated database retrieval system