KEGG   Synechocystis sp. PCC 6803: slr0618
Entry
slr0618           CDS       T00004                                 

Gene name
cbiP
Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00860  Porphyrin and chlorophyll metabolism
syn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    slr0618 (cbiP)
Enzymes [BR:syn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     slr0618 (cbiP)
SSDB
Motif
Pfam: GATase_3 AAA_26 CbiA SNO GATase DJ-1_PfpI GATase_5 DUF1611 Maf
Other DBs
NCBI-ProteinID: BAA10617
CyanoBase: slr0618
CYORF: slr0618
UniProt: Q55860
Position
2954506..2956089
AA seq 527 aa
MEPYSHRMECPRSFVFLADSSIQSKQNLTMKAIMVVGTTSHAGKSFLTTGLCRLLRRRGD
RVTPFKGQNMALNAFVTIDGGEMGHAQAVQAWAAGTVPRVAMNPILLKPQGDMTSQVIML
GQAVGTTRAQEYYQNYFDRGWQAIANSLETLAQDFDVVVCEGAGSPAEINLKHRDLTNMR
VATHLQAATILIADIDRGGVFAHVVGTLQLLEPEERKLIKGIVINKFRGQRSLLDSGITW
LEEYTGIPVLGVIPYGQNLFSAEDSLDILERSGRPSKEDIRIVVLRLPRIANFTDFEPLE
AESGVYVDYLPLEKQLGNPDAVIIPGSKTTIADLQALQNSGMAQQIMDYAQAGGTVMGIC
GGYQMLGQTIADPENIEGNVSNCQGLGLLPLTTVINQEKITRQCQTITHAPPSGLTVTGY
EIHQGLSRRSEHSQDFLPMFDQEELGMVNAQQNLWGCYLHGLFDNGAWRRCWLNNLRQRR
GLDPLPTSIGNYQEQREGMLDSLADFVETHVNLEPILQSLPEENETP
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggagccatacagtcatagaatggagtgccccaggagctttgttttcctagctgattct
tccattcagtccaagcaaaatttgaccatgaaagcaattatggtggtgggtaccacatcc
catgcaggcaagtcctttttgaccacagggctatgtcgtctgctccgtcgtcggggcgat
cgggtcaccccctttaagggacaaaacatggccctgaatgcctttgtcaccattgatgga
ggggaaatgggccatgcccaagcagtgcaggcctgggcagcggggactgttcccagggta
gcgatgaatccaattttgctcaaaccccagggggatatgacttcccaggtgattatgttg
ggccaggccgtaggtacaaccagggcccaggaatattaccagaattactttgaccgaggc
tggcaggcgatcgccaactctttagagaccctagcccaggattttgacgtagtggtatgc
gaaggggcaggcagtccagcagaaattaacctcaaacatcgagacttgaccaatatgcgt
gtggccacccatctccaggccgccaccattctcattgcagatattgaccggggtggggtc
tttgcccatgtggtcggtacattgcaactgttagagccggaggaaagaaaattaattaag
ggtattgttatcaacaaatttcgcggccaacgttccctgctggacagcgggattacttgg
ttggaagaatataccggcattcctgttttgggtgtcattccctacgggcaaaatcttttc
tccgccgaagattccctcgatatactagaaagaagtggccgccccagcaaagaagatatt
cgcatagtagtactgcgcttgccccgcattgccaactttactgacttcgagcccttggag
gcggaatccggtgtttacgtggattatcttcccttagaaaagcaactaggcaaccccgac
gccgtaattattcccggcagtaaaaccacgatcgccgatctgcaagcgctacaaaatagt
ggcatggcgcagcaaattatggattatgcccaagctggagggactgtgatgggcatttgt
ggcggctatcaaatgctggggcaaaccattgccgatccggaaaacatagaaggcaatgtc
agtaattgccaagggttggggcttttacccctaaccacggttattaaccaagaaaaaatt
acccgccaatgtcagaccatcacccacgctcccccatcaggtttaactgtcactggctat
gaaatccaccagggactaagtcggcgatcggagcatagccaagactttctgcccatgttt
gaccaagaagagctgggcatggtcaatgcccaacaaaacctttggggctgctacctccac
ggcctattcgataacggtgcttggcgacggtgctggttaaataatttacgtcaacgacgg
ggcttggacccattaccaacctccattggtaattatcaagaacaacgggaaggtatgtta
gattcattagcggattttgttgaaacccatgtcaaccttgagccgattttacaatctctc
ccagaggaaaatgagacaccttaa

DBGET integrated database retrieval system