KEGG   Synechocystis sp. PCC 6803: slr0624
Entry
slr0624           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
  KO
K01791  UDP-N-acetylglucosamine 2-epimerase (non-hydrolysing) [EC:5.1.3.14]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00520  Amino sugar and nucleotide sugar metabolism
syn00541  O-Antigen nucleotide sugar biosynthesis
syn01100  Metabolic pathways
syn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    slr0624
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    slr0624
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    slr0624
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:syn01005]
    slr0624
Enzymes [BR:syn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.14  UDP-N-acetylglucosamine 2-epimerase (non-hydrolysing)
     slr0624
Lipopolysaccharide biosynthesis proteins [BR:syn01005]
 Unusual sugar
  slr0624
SSDB
Motif
Pfam: Epimerase_2
Other DBs
NCBI-ProteinID: BAA10626
CyanoBase: slr0624
CYORF: slr0624
UniProt: Q55867
Position
2963397..2964512
AA seq 371 aa
MPVSPLSVCITLGTRPEAIKLAPVIRAFLAQPDMHTQVLLTGQHREMVQQVMDLFALSAD
ADLEIMQPGQTLTDITQGCLEGLGQLWQEKPPQLVIVQGDTTTAFAAALAAFYQQIPIGH
VEAGLRTDNLFNPYPEEANRRLISQIAQLHFAPTTLAVENLRRSDVTGEIHLTGNTVIDA
LLTVAEQKPACPIPGLDWQKHRVLLATVHRRENWGEPLQDILTSFSQILEQFPDTALLLP
MHRNPTVREPIQKALGNHPRVFLTEPLDYAQLVGAIQHCYLLLTDSGGLQEEAPSLGKPV
LVLRETTERPEAIAAGTAKLVGTDPAAVTKAAGELLSQPQAYEQMANAINPFGDGTASQK
IIEIVRNYFQH
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgcctgtatctcccctatcggtttgtattaccctgggcacccgccccgaggcgattaaa
ttagccccagtgatccgtgctttcctggcccagcctgatatgcacacccaagtgttgtta
acgggacagcatcgggaaatggtgcaacaggtgatggatttatttgcattgtcggcggac
gcagatctggaaattatgcaaccggggcaaaccctcacggacattacccagggctgttta
gaaggactaggacaactatggcaagaaaaaccgccccaattggtcattgtccagggggac
accaccactgcatttgctgcggccctggcagctttttaccaacaaatccccattggccat
gtggaagcaggtttacgcaccgataatttgtttaacccctatccagaggaagccaatcgc
cgtctaatttcccaaatagcccagttgcactttgcccccactaccttggcggtggagaat
ttacggcggtccgatgtcaccggggaaatccatttaacgggcaatacggtcattgatgcc
ctgttaacggtggcggaacaaaaaccagcctgtcccattccaggtttggactggcagaag
catcgagttttactggctacagtgcatcgccgggaaaattggggggagcccttgcaggat
attttgaccagttttagccaaattctagagcagtttcccgacacggccctattgctgccc
atgcaccgtaatcccactgtgcgggaaccgattcaaaaggcgttgggtaatcatccccgg
gtttttctgacagaacccttggattacgcccaattggtgggggcaattcagcattgttat
ttactgttgacggattccgggggtctgcaggaagaagctcctagtttgggaaaacctgtg
ttagtgttgcgggaaacaacggaacgcccagaggcgatcgccgctggaactgccaaatta
gtgggaacggatccagctgcggttacgaaggctgccggggaattactaagtcaacctcag
gcttatgagcaaatggccaacgccatcaatccttttggggatggtaccgctagccaaaaa
attatcgaaattgtccgtaactatttccagcattaa

DBGET integrated database retrieval system