KEGG   Synechocystis sp. PCC 6803: slr0645
Entry
slr0645           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: VWA_2 Copine vWA-TerF-like VWA_3
Other DBs
NCBI-ProteinID: BAA10368
CyanoBase: slr0645
CYORF: slr0645
UniProt: Q55727
Position
2674101..2674721
AA seq 206 aa
MSAEAVIENRDYTLMIDKSSSMATADDPNGPTRWEIAQASTIALAKKCEEIDSDGITVYL
FSGRFRRYDNVTAEKVAYIYANNEPMGRTDLAGALKDGLDNFFQRRQAGQTKPNGETFLI
ITDGEPTDRKAVIRLILEASQKIDRDEELAISLIQVGRDKKATAFFQALDDQLQAAGAKF
DIVDTVTMEDMQGMSLSDVLLKAITD
NT seq 621 nt   +upstreamnt  +downstreamnt
atgagcgctgaagctgtcatcgaaaaccgagactacaccctaatgatcgataaaagcagt
agcatggccaccgctgatgatcccaatggccccactcgctgggaaatagcccaagcttcg
accattgccctggcgaaaaaatgtgaagaaattgactccgacggcatcaccgtttatcta
ttctctggccgcttccgtcgttatgacaatgttaccgccgagaaagttgcttacatctac
gccaacaatgaacccatggggcgcactgatctggccggtgccctcaaggatggcctggac
aattttttccaacgacggcaggccggacaaactaaacccaatggggaaacttttctgatt
attaccgacggggaacccactgaccgcaaagcagttatccgtttaattttagaagcgagc
caaaaaattgaccgggatgaggagttagcgatttcgttgattcaggtgggcagggataaa
aaagcaacggccttttttcaggctttagatgatcaattacaggcggccggagcgaagttc
gacattgtggataccgtcaccatggaagatatgcagggcatgagcttgagtgatgtactg
ctcaaagcaattacagattag

DBGET integrated database retrieval system