KEGG   Synechocystis sp. PCC 6803: slr0747
Entry
slr0747           CDS       T00004                                 
Symbol
ggtA
Name
(GenBank) ATP-binding subunit of an ABC-type osmolyte transporter
  KO
K10112  multiple sugar transport system ATP-binding protein [EC:7.5.2.-]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:syn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    slr0747 (ggtA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    slr0747 (ggtA)
Transporters [BR:syn02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter
    slr0747 (ggtA)
   Maltose transporter
    slr0747 (ggtA)
   Arabinogalactan oligomer/maltooligosaccharide transport system
    slr0747 (ggtA)
   Raffinose/stachyose/melibiose transporter
    slr0747 (ggtA)
   Alpha-glucoside transporter
    slr0747 (ggtA)
   Glucose/mannose transporter
    slr0747 (ggtA)
   Trehalose/maltose transporter
    slr0747 (ggtA)
   Cellobiose transporter
    slr0747 (ggtA)
   N,N'-Diacetylchitobiose transporter
    slr0747 (ggtA)
   L-Arabinose/D-xylose transporter
    slr0747 (ggtA)
   Fructooligosaccharide transporter
    slr0747 (ggtA)
   Putative sorbitol/mannitol transporter
    slr0747 (ggtA)
   Arabinooligosaccharide transporter
    slr0747 (ggtA)
   Polygalacturonan/rhamnogalacturonan transporter
    slr0747 (ggtA)
   Pectin-derived oligosaccharide transporter
    slr0747 (ggtA)
   Putative multiple sugar transporter
    slr0747 (ggtA)
SSDB
Motif
Pfam: ABC_tran OB_MalK TOBE_2 Rad17 AAA_22 AAA_21 RsgA_GTPase CysA_C_terminal AAA_16 AAA AAA_33 AAA_28 SRP54 AAA_30
Other DBs
NCBI-ProteinID: BAA18741
CyanoBase: slr0747
UniProt: Q79EE4
Position
3410761..3411852
AA seq 363 aa
MASVSFEQVTKQFDDYVAVNNLNLEIEDGEFLVFVGPSGCGKTTSLRLLAGLETVSQGQI
CIGDRRVNELSPKDRDIAMVFQSYALYPHMSVYENMAFSLDLQGKPKEEIRQRVCSAAEL
LGIEKLLHRKPKELSGGQRQRVAVGRAIVRKPSVFLMDEPLSNLDAMLRVQARKEISKLH
SDLATTFIYVTHDQVEAMTMGDRIAVMKDGILQQVDSPANLYNQPANLFVAGFIGSPAMN
FFQVERLSQEGKEKLSLDGVVLPMPDSVAKNGDRPLTLGIRPENIYHPQYLPLEIEPMEL
PATVNLVEMMGNELIVYAQTPAGTEFVARIDPRVNIKQKDSVKFVVDTQRFYYFDREMET
AIF
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggccagtgtcagttttgaacaggtaactaaacagtttgatgattatgttgccgttaat
aacttgaatttggaaattgaggacggggagtttttagtttttgtggggccgtctggttgc
ggcaaaactacctccctacgacttttagccgggctggaaaccgttagtcaaggacaaatc
tgcattggcgatcgccgggtgaatgaactatctcccaaagaccgggacattgccatggta
ttccagtcctatgccctctatccccacatgagtgtttatgaaaatatggcctttagcctc
gacttacagggcaaacccaaagaagaaattaggcaaagggtctgtagcgccgctgaattg
ttgggcatcgaaaaattactgcatcgtaaacccaaggaattgtcggggggacagcggcaa
cgggtggcagtggggagagccattgtccgtaaaccctctgtgtttttgatggatgaaccc
ctttctaatctggatgccatgctccgggtgcaagcccgcaaagaaatcagtaaactccat
agcgacctggccactactttcatttacgttacccatgaccaggtggaagctatgaccatg
ggcgatcgcattgctgtgatgaaggatggcattttgcaacaggtggacagtccagctaat
ttgtacaatcagcccgctaacctatttgtggctggtttcattggcagtcccgccatgaac
ttttttcaggtggaaagattaagtcaggaaggaaaagaaaagctgagtttggacggtgtt
gttttaccaatgccagacagtgtagccaaaaacggcgatcgccccctaaccctcggtatt
cgccctgaaaatatttaccatccccaatatttgcccttggaaattgaacccatggagttg
ccagccacagttaacctagtggaaatgatgggcaatgaattaattgtttatgcccaaact
cctgccggtacagaatttgtggcccgcattgaccccagggtaaatattaagcagaaagac
tcagttaaatttgtggttgatacccaacgtttttactattttgaccgggaaatggaaacg
gcgatcttttaa

DBGET integrated database retrieval system