KEGG   Synechocystis sp. PCC 6803: slr0783Help
Entry
slr0783           CDS       T00004                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00010  Glycolysis / Gluconeogenesis
syn00051  Fructose and mannose metabolism
syn00562  Inositol phosphate metabolism
syn00710  Carbon fixation in photosynthetic organisms
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
syn01120  Microbial metabolism in diverse environments
syn01130  Biosynthesis of antibiotics
syn01200  Carbon metabolism
syn01230  Biosynthesis of amino acids
Module
syn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    slr0783 (tpi)
   00051 Fructose and mannose metabolism
    slr0783 (tpi)
   00562 Inositol phosphate metabolism
    slr0783 (tpi)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    slr0783 (tpi)
Enzymes [BR:syn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     slr0783 (tpi)
Exosome [BR:syn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   slr0783 (tpi)
  Exosomal proteins of bladder cancer cells
   slr0783 (tpi)
  Exosomal proteins of melanoma cells
   slr0783 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Hs1pro-1_N
Motif
Other DBs
NCBI-ProteinID: BAA10145
CyanoBase: slr0783
CYORF: slr0783
UniProt: Q59994
Position
2423621..2424349
Genome map
AA seq 242 aa AA seqDB search
MRKIIIAGNWKMHKTQAEAQAFLQGFKPLIEDAAESREVVLCVPFTDLSGMSQQLHGGRV
RLGAQNVHWEASGAYTGEISAAMLTEIGIHYVVIGHSERRQYFGETDETANLRVLAAQKA
GLIPILCVGESKAQRDAGETEQVIVDQVKKGLVNVDQSNLVIAYEPIWAIGTGDTCAATE
ANRVIGLIREQLTNSQVTIQYGGSVNANNVDEIMAQPEIDGALVGGASLEPQSFARIVNF
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaaaatcattattgcgggcaattggaaaatgcataagacgcaggcggaggcccaa
gcgtttttgcaggggtttaaacctttaatcgaagatgcggcggaaagtcgtgaggtggtg
ttgtgtgttcctttcaccgatttgagcggcatgtcccaacaactccatggcggtagggtc
cgcctaggggcacaaaatgtccattgggaagcgagtggggcctacacaggggaaatttca
gcggctatgttgacggaaatcggtattcattatgtggttatcggccacagtgaacgacgg
caatattttggggaaacggacgaaactgccaatttgagagtattggcggcccaaaaggcg
ggcttaattcccattctgtgtgtgggggaaagtaaggcgcaacgggatgccggagaaacg
gaacaggttatcgttgaccaagtgaaaaaaggcttggtgaatgtggatcaatctaaccta
gtcatcgcctacgagccgatttgggccattggtacaggggacacctgtgcggcaacggaa
gccaatcgggttattgggctgattcgggaacagttaactaattcccaggtcaccatccag
tatggcggttcggtcaatgccaacaatgtggatgaaattatggcccaaccggaaattgat
ggagccttggtgggaggagctagtctggaaccccagagctttgcccgcattgttaatttt
cagccctga

DBGET integrated database retrieval system