KEGG   Synechocystis sp. PCC 6803: slr0796
Entry
slr0796           CDS       T00004                                 
Symbol
nreB
Name
(GenBank) nickel resistance
  KO
K07785  MFS transporter, NRE family, putaive nickel resistance protein
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:syn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    slr0796 (nreB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    slr0796 (nreB)
Transporters [BR:syn02000]
 Major facilitator superfamily (MFS)
  Metal transporters
   Nickel resistance (Nre) family [TC:2.A.1.31]
    slr0796 (nreB)
SSDB
Motif
Pfam: MFS_1 MFS_3
Other DBs
NCBI-ProteinID: BAA10702
CyanoBase: slr0796
CYORF: slr0796
UniProt: Q55937
Position
3055814..3057151
AA seq 445 aa
MGKLPPIFHCLRNRLFAQLYLAQAISLLGDALTWVGLALLAFELAGQGAGLILAGALTLR
VTVFVLLSPIAGAIADRYDRKQMMVITHLARLGIVCLFPGVTQAWQIYGLVLGLNVFNAF
FTPTYTATIPLVTKEDEYPQAIALSSATYQLLGVLGPGLAGSLAAWVGTKTIFWGDALTF
LMAAGLIFTLPGKLLANSTAQPVRNLAQIRRDIGTGTQCLFGDRLIRYALAMQLVVSLAG
AGILVNTVGYVQGILNLGKLEYGWLMAAFGLGATVASLGLGNTQQQRKRIYLTTIGAVVM
SLAILPVSMVNLQGLLLLWAGAGIGQTLVNVPTQTLIADRVAKELQGRVYGANFAWSHLW
WAFSYPLAGWLGSHFAQNSFFYLGILALSLFALFYLLRPSTPMEPGFWHEHSHHHDSEHS
HFHPATTVLNFSHNHLHFHFYKASP
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgggcaaactaccgcctatctttcactgcttgcggaaccgtctatttgctcagctatac
ctagcccaagccattagtttgctgggggatgccctgacctgggtaggattagcactttta
gcttttgaattggcgggtcaaggggcggggttgatcctggcaggggccttaaccttaagg
gtaacggtgtttgtcttgctgtctcccattgcgggggcgatcgccgaccgttatgatcgc
aagcaaatgatggtgattacccatctggcacggctggggattgtctgtttatttcctggg
gtgacccaggcctggcaaatctacgggctggttctggggctgaatgtgtttaacgccttt
tttactccgacctataccgcaaccattcccctggtgacgaaggaggatgaatatccccag
gcgatcgccttatccagtgccacttatcaacttttgggggttttggggccagggttggct
gggagtcttgccgcttgggtgggaacaaaaacaatcttttggggggatgctttaactttt
ttgatggccgctggtttaatttttaccttgccaggaaaactgttagctaattcaaccgcc
cagcctgtccgtaacttggcccaaattcgacgggacatcggcacaggaacccaatgtctt
ttcggcgatcgcctgattcgttatgctctagcgatgcagttggtggtgtccttggccggg
gcagggattttagtgaatacggtgggctatgtccaaggcattttaaacctgggtaagctg
gagtatggttggctaatggcggcgtttgggttgggagcgacggtggcttccctcggtttg
ggcaacactcagcaacagagaaaacgaatctatttaacgacaattggggctgtagtaatg
agtcttgcgattctacccgtctcgatggtcaatcttcagggattattgctcctgtgggct
ggggctggtatcggccaaaccttggttaatgtccccacccaaaccctgattgccgaccgc
gtagccaaagagcttcaaggccgagtgtatggtgccaattttgcctggagtcatctctgg
tgggcgttttcctatcctctggcgggatggttaggcagtcactttgctcaaaatagtttt
ttctatctggggattttagccctcagcttatttgccctgttttatctgttacgaccctcc
actccgatggaaccaggattttggcacgaacattcccatcaccatgactccgagcatagt
cattttcatcctgcgacaactgtgctgaattttagccacaatcatcttcatttccatttt
tataaggcgagtccttaa

DBGET integrated database retrieval system