KEGG   Synechocystis sp. PCC 6803: slr0829
Entry
slr0829           CDS       T00004                                 

Definition
(GenBank) PleD gene product homologue
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: GGDEF PAS_3 PAS_4 PAS_9 PAS PAS_8 HAMP PAS_12 DUF4282 TBCA
Other DBs
NCBI-ProteinID: BAA10511
CyanoBase: slr0829
CYORF: slr0829
UniProt: Q55414
Position
2833378..2835867
AA seq 829 aa
MLQVLLVMAVLVFSALSLDFFGQLNNNVYLFLVLGIIIFLIPALTSLYIARLVIEPLRKL
VTTSQNLAQGTSHGTITQPVAIAEIQQLAKAINGMALRLQQSLAQTKEELQGSKELYRQV
VQSQTDFILRSQPDTTITFANDALCQALGLALPEVIGLQWLDFIVEEDLKIVLDKIACLT
PEQPQFINENQDKRAGGVLGYTQWVSRGIFNDKGQLIEIQSVGRDISALKETQLELRQSQ
KFIESIAEATPSLLYIYDHIKQANIYSNRSVAEFLGYSPEEIKTMGASLFTNICHPEDLP
RILAAIENCQKLRDGEILEIEYRVRDARQQWRWLLSRDLVFTRTETGQLWQTLGTAQDIT
QRKEAEIELEKIKTFLASIVENIPDMIFVKDAKTLRFLELNKAGESLIGYTKEEVLGKND
YELFPQERAEWFIQEDRQVLLSGEVQDIPMEVIQTCHEGIRILHTKKIPICDASGQAQYL
LGISADITDLLESQQRLQELARHIPGVIYQFRMRPDGTFHFPYASEGIRKIYGVSPEEVK
EDATPVFNVLHPDELPGVSRSIYESAANLTPWYYEYRVCFADGRVIWVLGYATPRRESDG
GTIWHGYIKDITDRKEEEYLLIKAKERAETAEQTLQKAQIRLERFNKKLSQLIDIDGLTK
IANRRCFNVRIKQEWRRLSRAQVPISLIMFDIDCFKNYNDRYGHPEGDLCLIRVAQAARK
AASRPADLVARFGGEEFAVLLPETDTKGAIMVAEKIIQAISQLAIAHEASPISGQITISL
GIGTQFPSKELISRTLIKQADMALYEAKRRGRNQYVVWTEELEGESSLS
NT seq 2490 nt   +upstreamnt  +downstreamnt
gtgctgcaagttttgctggttatggcagttttggtcttttccgcgctatcgttagatttt
ttcggtcaacttaataataatgtctatctttttctagttctgggcattatcattttttta
attcccgccctgactagtctctacattgctcgtttagtcattgaacccctacgaaaacta
gttactaccagtcaaaatttagcccaaggcacttcccacggcaccataacacaaccagtg
gccattgccgaaattcagcagcttgccaaagccatcaatggtatggccctccggttacaa
caatccctggcacaaaccaaggaagaactccaaggctccaaagaactatatcggcaagta
gtacaaagtcagacagattttattttacgctcccaaccagataccaccatcacctttgcc
aacgatgccctttgtcaagccctagggcttgctttacccgaggtaatcggcttgcaatgg
ctagacttcattgttgaagaagacttgaaaatagtgctggacaaaatagcctgcttaacc
ccagaacagccacaatttatcaatgaaaatcaggataaaagggcaggaggagtattaggt
tacacccaatgggttagtcggggaattttcaatgacaagggtcaattaattgaaattcag
tccgttggtcgggatatttcagccctgaaagaaacccaactggaattaagacaaagtcaa
aaatttattgaaagcattgccgaagcaacccccagccttctatacatatatgaccatatt
aagcaagccaatatctatagtaatcgttctgttgctgaatttttaggttattctccagaa
gaaattaaaacaatgggggccagcttgtttacaaatatttgccatccagaagacttgcca
cgaattttagccgccattgaaaattgtcaaaaattaagggacggtgaaatacttgaaatt
gagtatcgtgtccgagatgctagacaacaatggcgctggctcctaagccgagacttagtt
tttacccgcacagaaacaggacaactttggcaaaccttaggcacagctcaggatattacc
caacggaaagaagcggaaatagagttggaaaaaattaaaacttttcttgcttccattgtg
gaaaatattcctgacatgatctttgttaaagatgcaaaaactctgagatttttagaatta
aataaagctggtgaaagtttaatcggttatacgaaagaagaagtgttaggaaaaaatgat
tatgagctatttcctcaggagcgggctgaatggtttatccaagaggataggcaagtttta
ctatctggagaagttcaagatatccccatggaagttatccaaacctgccacgaagggata
cgtattttacacactaaaaaaatccctatttgtgacgcatccggtcaagcgcaatattta
ttgggtatttccgctgatattactgatctgttggaatcccaacaacgtttgcaggaatta
gctcgccatattccgggggtaatctatcagtttcgcatgcgtcccgatggtacttttcac
tttccctatgccagtgaggggattcggaaaatttatggagttagccctgaggaggtaaaa
gaagatgccaccccagtttttaacgtgttgcaccctgatgaattgccaggagtttcccga
tccatttatgagtctgcagcaaacctaactccctggtattacgagtatcgagtttgtttt
gctgatggacgagtgatctgggtattaggctacgccacgccccggagggaaagcgatgga
ggaaccatttggcatggctatattaaagacattactgatcgcaaagaagaagaatattta
ttaattaaagccaaagaaagggcagaaacagcggagcaaaccttacaaaaagctcaaatt
cggctagaaaggtttaataaaaaactaagtcaattaatagatattgatgggttgacgaag
attgctaaccgtcgttgctttaatgtccgcattaaacaagagtggcggagattatctagg
gctcaagtgcccatatccttaatcatgtttgatatagattgcttcaaaaattacaatgac
cgctatggccatccggagggggatctgtgcttaattagggtggcccaagcagctagaaaa
gctgccagtcggccagcggacttagtggcccgttttgggggggaagaatttgcggtgctt
ttgcccgaaaccgacaccaagggggcaattatggttgccgagaaaatcattcaagccatc
agccaattggcgatcgcccatgaagcttcccccattagtgggcaaatcacaatcagtttg
ggcatcggcacccagtttccctccaaggaactcatctccaggacccttatcaaacaagcg
gatatggccctgtatgaagcaaaacgccggggcagaaatcagtatgtggtctggacggaa
gaactggaaggggagtcctcactttcatga

DBGET integrated database retrieval system