KEGG   Synechocystis sp. PCC 6803: slr0833Help
Entry
slr0833           CDS       T00004                                 

Gene name
dnaB
Definition
(GenBank) replicative DNA helicase
  KO
K02314  replicative DNA helicase [EC:3.6.4.12]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn03030  DNA replication
Brite
KEGG Orthology (KO) [BR:syn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    slr0833 (dnaB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:syn03032]
    slr0833 (dnaB)
Enzymes [BR:syn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     slr0833 (dnaB)
DNA replication proteins [BR:syn03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    slr0833 (dnaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaB_C Intein_splicing DnaB LAGLIDADG_3 AAA_25 ATPase Ubiquitin_4
Motif
Other DBs
NCBI-ProteinID: BAA10516
CyanoBase: slr0833
CYORF: slr0833
UniProt: Q55418
Structure
PDB: 

Position
2839957..2842575
Genome map
AA seq 872 aa AA seqDB search
MAANPALPPQNIEAEECILGGILLDPEAMGRIIDLLVVDAFYVKAHRLIYEAMLSLHGQS
QPTDLMSVSSWLQDHHHFEAIGGMVKLTQLLDRTISAVNIDRFAALIMDKYLRRQLIAAG
HDIVDLGYETSKELETIFDESEQKIFRLTQSRPQAGLVPLSETLVNTFIELDKLHEKLSS
PGVETQFYDLDAMTGGLQRADLIILAGRPSMGKTAFGLGIAANIAKNQNLPVAIFSLEMS
KEQLALRLVASESLIDSNRLRTGHFSQAEFEPLTAAMGTLSSLPIYIDDTASISVTQMRS
QVRRLQSEQKGPLGMVLIDYLQLMEGGSDNRVQELSKITRSLKGLAREINAPVIALSQLS
RAVESRTNKRPMMSDLRESGCISGDSLISLASTGKRVSIKDLLDEKDFEIWAINEQTMKL
ESAKVSRVFCTGKKLVYILKTRLGRTIKATANHRFLTIDGWKRLDELSLKEHIALPRKLE
SSSLQLMSDEELGLLGHLIGDGCTLPRHAIQYTSNKIELAEKVVELAKAVFGDQINPRIS
QERQWYQVYIPASYRLTHNKKNPITKWLENLDVFGLRSYEKFVPNQVFEQPQRAIAIFLR
HLWSTDGCVKLIVEKSSRPVAYYATSSEKLAKDVQSLLLKLGINARLSKISQNGKGRDNY
HVTITGQADLQIFVDQIGAVDKDKQASVEEIKTHIAQHQANTNRDVIPKQIWKTYVLPQI
QIKGITTRDLQMRLGNAYCGTALYKHNLSRERAAKIATITQSPEIEKLSQSDIYWDSIVS
ITETGVEEVFDLTVPGPHNFVANDIIVHNSIEQDADLIMMIYRDEYYNPDTPDPGVAELL
IVKHRNGPTGVVKLLFKPEFTQFLNLQRSNDY
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaaccctgccctgcccccccaaaacattgaagctgaagagtgcatcctgggg
gggattctcctcgatccagaggccatggggcgcatcattgacctcctggtagtagacgct
ttttacgtcaaggcccatcgtttgatctatgaggccatgcttagtctccatggccaaagt
cagcccacggatttgatgtctgtcagcagttggctccaagatcaccatcatttcgaggcg
atcgggggcatggtgaaattaactcaattattagatcgcaccatttcagcggtgaacatt
gaccgttttgccgccctaatcatggataaatatttgcgtcgccaattaattgcagcgggg
catgacatcgttgatttgggttacgaaactagcaaagaattagaaacaattttcgatgaa
tcggaacaaaaaatatttcgcctcacccaatctcgtccccaagcagggctagtaccgtta
tcagaaaccttagttaatactttcattgaattagataaattacacgaaaaactttccagt
ccaggggtagaaacccaattctatgatcttgatgcaatgacagggggattacagcgggca
gatttaattattttggccggcaggccgtcgatgggaaaaacggcattcggtttaggaatt
gccgctaacatcgctaaaaaccagaatttgcctgtggctatttttagcttagaaatgtcc
aaggaacagttggcattaagactagtggctagtgaatccttaattgatagtaaccgttta
cggacagggcactttagccaagcagaatttgaacctttaacggcggccatgggcaccctt
tccagtttacctatctacattgacgatacggcaagtatttccgtaacccaaatgcgttcc
caggtgcgtcgcctccaaagtgaacaaaaaggtccattgggtatggttctaattgattat
ttgcaactgatggaaggaggcagtgataatcgggtacaggaattatcaaaaattacccgt
tctctcaaaggtttagccagggaaattaacgcgccagtaattgctttatctcagttaagt
cgagcggtggaatctagaactaacaaacggccaatgatgtcagatttaagagagagtggc
tgcatcagtggagatagtttgatcagcttggcgagcacaggaaaaagagtttctattaaa
gatttgttagatgaaaaagattttgaaatatgggcaattaatgaacagacgatgaagcta
gaatcagctaaagttagtcgtgtattttgtactggcaaaaagctagtttatattttaaaa
actcgactaggtagaactatcaaggcaacagcaaatcatagatttttaactattgatggt
tggaaaagattagatgagctatctttaaaagagcatattgctctaccccgtaaactagaa
agctcctctttacaattaatgagtgatgaggaactaggattactagggcatctaattggt
gatggctgtactttacctcgccatgctattcaatatacaagcaataaaatagaattagct
gaaaaggtagtcgaattagcaaaagcagtttttggcgaccaaattaatcctcgtatcagc
caagaaaggcaatggtaccaagtttatatccctgctagttatcggctaacccataacaaa
aaaaatccgattacaaaatggctagagaatttagacgtattcggactgcgttcctacgaa
aaatttgttcctaatcaagtttttgaacaaccacagagggcgatcgccatttttctaaga
catttatggagtacagatggttgcgtcaaattaatagtagaaaaatcatctagaccggta
gcttattacgcaactagtagcgagaagttagcaaaggatgtacagtcgttactcttgaaa
ttaggcattaacgcacgtctatcaaaaataagtcagaatggcaaaggcagggataactat
catgtaaccattacagggcaagctgatttacaaatctttgttgatcaaattggcgctgtt
gacaaagacaaacaggcaagtgttgaggaaattaaaacccatatcgctcaacatcaagca
aacactaacagggatgtcattccaaaacaaatttggaagacctatgtgttgccacaaatt
caaataaaagggataactactcgcgacttgcaaatgagacttggtaatgcctactgtggg
acagctctttataaacataatttgagtagggaaagagcagcaaaaatagccactattacc
caatcaccagaaatagaaaagttgtctcagagtgatatttactgggactccatcgtttct
attacggagactggagtcgaagaggtttttgatttgactgtgccaggaccacataacttt
gtcgccaatgacatcattgtccataacagtatcgaacaagacgcagatttaattatgatg
atttatcgagatgaatattataatcccgacacgccggacccaggggtagcagaattgcta
attgttaaacatagaaatggacccactggcgtagttaaattgttatttaaaccggaattt
acccaatttttaaatttgcaacgaagtaatgattactag

DBGET integrated database retrieval system