KEGG   Synechocystis sp. PCC 6803: slr0835Help
Entry
slr0835           CDS       T00004                                 

Gene name
moxR
Definition
(GenBank) MoxR protein
  KO
K03924  MoxR-like ATPase [EC:3.6.3.-]
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    slr0835 (moxR)
Enzymes [BR:syn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     slr0835 (moxR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_3 AAA_lid_2 AAA_5 AAA Mg_chelatase Sigma54_activat RuvB_N AAA_2 MCM AAA_16
Motif
Other DBs
NCBI-ProteinID: BAA10517
CyanoBase: slr0835
CYORF: slr0835
UniProt: Q55419
Position
2842772..2843683
Genome map
AA seq 303 aa AA seqDB search
MREQISVLTQNLSQTIVGKDEAIRLVLVALLSGGHALLEDVPGVGKTLLAKSLARSINGK
FQRVQCTPDLLPTDITGTNIWNPSSREFEFLPGPAFANILLADEINRATPRTQAALLEVM
EEKQVTVDGETRLVPHPFFVIATQNPIEYQGTFPLPEAQLDRFALSLSLGYPSEAEELKM
LQRQQNPEAIAVGDLESCISLEEVEALQKAVRQVKLTEDLQQYLLRLVRASRTDEDVTLG
VSPRGTTALQRATQAFAFLEERDYAIDDDVKFVAPHVLAHRLIPASGKDPKAILQRLLDS
VPI
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaacagatttctgtccttacccaaaatcttagtcaaaccattgtgggcaaggat
gaggctattcgtttggtgttggtggccctgttgagtgggggccatgctttgctggaagat
gtgcccggtgtgggcaaaaccctcttagctaagtccctggcccgttccattaacggcaag
tttcagcgggtgcagtgtacccccgatttattaccaacagatattaccggcactaacatt
tggaaccccagtagtcgtgagtttgagtttttgcccggcccggcgtttgccaatattctc
ttagccgatgaaattaaccgggctaccccccgcacccaggctgctttgttggaggtgatg
gaagaaaaacaggtcacagtggacggtgaaacccgtttggtgccccatccgttttttgtc
attgctacccaaaatcccattgagtaccagggcacttttcccttgccagaggcccagtta
gatcgttttgccctttccctcagtttgggttatccgtcggaagcagaagaactgaaaatg
ctccagcggcaacaaaatccagaggcgatcgccgtgggagatttagagtcttgcatttcc
ttggaagaagtggaggcattacaaaaagcggtgcggcaggtaaaactaacggaggatttg
caacagtatctcctacgcttagtgcgggcctcccggactgatgaggacgttactttgggg
gttagtccccggggcacaacagctctacaacgggcaacccaagcctttgcctttttggaa
gaacgggattatgccattgacgacgatgtgaaatttgttgctccccatgtgttagcccac
cgcttaattcctgcgagcggcaaagatcccaaggcaattttgcaaagacttttggacagc
gtacccatttaa

DBGET integrated database retrieval system