KEGG   Synechocystis sp. PCC 6803: slr0846
Entry
slr0846           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Rrf2 TrmB
Other DBs
NCBI-ProteinID: BAA10535
CyanoBase: slr0846
CYORF: slr0846
UniProt: Q55433
Position
2862558..2863031
AA seq 157 aa
MGKDGFYTKGMKLTTKSHYSVKALLDLALQPDYGPASVKAIAERQNIPGPYLEKLLITLR
RAGIVNAYRGVRGGYQLAQAPDQISLGQILAALEESLEPFPQYGDDQSLAEDWVTLSVWR
QLHQKFVKALYSITLADLYYDARSWQAAQGEGINFIV
NT seq 474 nt   +upstreamnt  +downstreamnt
atgggcaaggatggcttctatactaaagggatgaagttgacaacaaaaagccattacagt
gttaaagccttactggatttagctctacaaccggactacggccctgcttcggtgaaggcg
atcgccgagcgacagaatatccctgggccctatctggaaaaactgttgattaccctgcga
cgggcgggcatagttaatgcctatcggggggtgaggggaggatatcaattggcccaggcc
ccggatcaaatttccctggggcaaatattagcggccctggaagaaagcctggaaccattt
ccccaatatggggatgaccaaagtttggcggaggattgggttaccctcagtgtgtggcga
caactacaccaaaaatttgtcaaagctctctattcaattactttggctgacctttattac
gatgcccgcagttggcaggcggcccaaggggaagggattaattttattgtttga

DBGET integrated database retrieval system