KEGG   Synechocystis sp. PCC 6803: slr0881
Entry
slr0881           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: MLANA TPR_16 DUF3240 HemY_N
Other DBs
NCBI-ProteinID: BAA17604
CyanoBase: slr0881
CYORF: slr0881
UniProt: P73564
Position
1142101..1142412
AA seq 103 aa
MLALILAIALLWGLIWWARRRSGRKIAWSRGRRHSSGFKQAIQASRPTSPRVPGKLRRDL
IRIAGNAQVAERLVTNLRAKHPDRPEHWYWEKAIFDLERDRHY
NT seq 312 nt   +upstreamnt  +downstreamnt
atgttggccctaattttggcgatcgccctgttgtggggcttgatctggtgggctaggcgt
agatcaggtcggaaaattgcctggagcagaggccgtcgtcattcatcaggtttcaagcag
gccatccaagcttcccgcccaacatcacccagggtgcccggtaagttacggcgggatcta
attcgtattgcgggcaatgcccaggtagcggaaagactggtaaccaatctacgggccaaa
catcctgatcgcccggagcactggtattgggaaaaggcaatttttgacctggagcgcgat
cgccattattag

DBGET integrated database retrieval system