KEGG   Synechocystis sp. PCC 6803: slr0883
Entry
slr0883           CDS       T00004                                 

Gene name
psr
Definition
(GenBank) regulation of penicillin binding protein 5 production
  KO
K01005  polyisoprenyl-teichoic acid--peptidoglycan teichoic acid transferase [EC:2.7.8.-]
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    slr0883 (psr)
Enzymes [BR:syn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     slr0883 (psr)
SSDB
Motif
Pfam: LytR_cpsA_psr LytR_C
Other DBs
NCBI-ProteinID: BAA17607
CyanoBase: slr0883
CYORF: slr0883
UniProt: P73567
Position
1144728..1146173
AA seq 481 aa
MANSTESGSLQSSSTVKVRSHYRPNNGTGSPGGRPRPKRGFLPLGKGLVWGGLVTLTATV
AAIAGVGIGFFTPGPKGLVQQVIPGQSAGVEAGQADLFPYHISRPVNILVMGIDRVEPTE
EEPNVDEFGGRSDTMLLVRFDPRENGLKLLSIPRDTRVFIPDVGYTKINDANAYGGPQLA
ARVINRNLGEVPIDRYVRVTTDALQELVDLVGGVEVFVPRPMFYEDKTQQLLIDLPAGLQ
TLNGQQAEQFVRFRYDANGDIGRVQRQETLLKALQNRLSHPSMITRIPKAIGIMQKTVDT
NLTMEEILALVNFGRQLDRQEVQMVMLPGRFSQPAEFDGRSYWVMSDVGKRQVLRNYFDV
IEEVPTWAETPGRSPESLRIALQNATDDPQALERVKEYLQSKDFRNFYETSESPQLLAET
KILVQRGDLDGAHYLRQTLGGGVVEASSVGDLGSDLTIQVGMDLDQWLKESTPVDDSTPQ
F
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggcgaatagtaccgagtctggttcgttgcagtcctccagcaccgtcaaggttcgctcc
cattaccgacccaacaatggcactggttcccccgggggtcgtccccggcccaaaaggggt
tttcttcccctaggcaagggcttggtttggggggggttagtgactttgactgccactgta
gcggcgatcgccggggtgggcatcggcttttttacccctgggccaaaggggctagttcag
caggttataccggggcagtcggccggagtagaagccggtcaggcagatctatttccctat
cacatcagtcgtcctgtcaacattttggtgatgggcattgaccgggtagaacccacagag
gaagaacccaatgtggatgagtttggtggccgcagtgacaccatgctattggtacgattc
gatccgagggaaaatggtttgaaattactttccattccccgggataccagggttttcatt
cccgatgtgggctataccaaaatcaacgatgccaatgcctatgggggcccgcagttggcg
gcaagggtaatcaaccgtaacttgggggaagtccccatcgaccgttacgtcagagtcacc
accgacgcattacaggaattggtggatttagtggggggagtggaagtgtttgtaccccgg
cccatgttttacgaagataaaacccagcagttattaatcgatttacccgccggactgcaa
accctgaatgggcaacaggcagaacaatttgtccgttttcgctacgacgccaatggggat
attggccgggtacaacggcaggaaaccctgctcaaagccctgcaaaatcgccttagccat
cccagtatgatcacccgcattcccaaggccattggcattatgcagaaaactgtggacaca
aatttaaccatggaggaaattctggccctggttaattttgggcgtcaacttgatcgccag
gaagtgcaaatggtaatgttaccggggcggtttagccaaccggcggaatttgatggccgt
agctattgggtgatgtccgatgtcggcaaaaggcaagtgctcaggaactactttgatgtc
attgaagaagtccccacttgggctgaaactcccgggcgatcgccggaaagtttacgcatt
gccctgcaaaatgccactgacgatccccaggccctggaacgggtgaaggaatatttacaa
tccaaggacttccgcaatttttatgaaacatcggaatccccgcaactattagcagagaca
aaaattctggtacagcggggggacttagatggagcccattatctgcggcaaaccttgggg
ggaggagtggtggaagcttcctccgtcggcgacctaggctcggatttaactattcaagtg
ggcatggaccttgaccaatggctcaaggaatctaccccggtggacgactccacccctcaa
ttttga

DBGET integrated database retrieval system