KEGG   Synechocystis sp. PCC 6803: slr0890
Entry
slr0890           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: gag-asp_proteas Asp_protease_2
Other DBs
NCBI-ProteinID: BAA17619
CyanoBase: slr0890
CYORF: slr0890
UniProt: P73579
Position
1156580..1156975
AA seq 131 aa
MGLVYANIELINPKEQALQPMKVNALVDTGAITLCIPEHVVIQLKLETLEQREVTTADSK
KRLVDYVGPVQVRFGNRNCFTGALVLGDAVLLGAVPLEDMDLVISPRSQTITVNPESPNI
PAALVKTALEI
NT seq 396 nt   +upstreamnt  +downstreamnt
atgggtttagtttatgccaatattgagcttatcaatcccaaagaacaggctctacaacca
atgaaggtcaatgccttagttgatacaggggcgattacactttgtattcctgagcatgtt
gtgattcaacttaagttagaaacgttggaacaacgggaagttactactgccgacagcaaa
aaaagactagttgattatgtgggaccagtgcaagtgaggtttggtaatcgtaattgtttt
actggagccctagtcttaggggatgcagttttgctaggggctgttcctttggaagatatg
gatttagttattagtccccgttcacaaaccattaccgtcaatcctgaaagtcctaatatt
cctgcggcgctggtaaaaactgcactggagatttaa

DBGET integrated database retrieval system