KEGG   Synechocystis sp. PCC 6803: slr0897
Entry
slr0897           CDS       T00004                                 

Definition
(GenBank) endo-1,4-beta-glucanase
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00500  Starch and sucrose metabolism
syn01100  Metabolic pathways
syn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    slr0897
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    slr0897
Enzymes [BR:syn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     slr0897
SSDB
Motif
Pfam: Glyco_hydro_9 CBM_2
Other DBs
NCBI-ProteinID: BAA10447
CyanoBase: slr0897
CYORF: slr0897
UniProt: Q55365
Position
2765554..2768766
AA seq 1070 aa
MNSILSPITVAVGGSLWWNGFTADFTITNTSTTSLSNWTYTFDTVHKISGNPWGATFTSV
DLGNGITRYTLTGAGWASSIPPGGSVTIGFNGTQGTAIGNSGSLTSALLFTDVNANTGGT
GGEHQHPDPIPPTDPVVDPTPNPGTGRVFAANPAAADIVGFNPAVDRLDFGDVSVHNLIL
GKTSTGKVAIINPWAWTPEFQIIRGVSFDDLTAANFGIVQNEHLRQDIGGVLSWELGLGA
RNSNTVYVRSHEYGVQERIENFNPATMKLSFLYYGTRERLTVSDTPEGLLIATQPTGQTL
LLVGVTRSQLIPANLEFHHDQVVEDRLEDAFGVTVEQVTVVSRTGLATPQGPAGQITDGH
QSRPGNGLTPIGGGEFSGGAGGHGSGHDHGDHDHGGGMDHGSDPGDGMGGGTTNPPVTDP
VTPPPTDPVSPTSPFTVTVGGNRWWNGFTAELTVTNVSGTKLNSWSFTFDTVHKISGSPW
GATVQSTDLGGGITRYVVTGSEWAASIAPGSSVKVGFNGTQGTAIANDGALTADLLFLGG
GIVGQPSTGSGGNTGGTPTNPNPPTDPINPNPNPVDPVDPPAIANGDHNYGEALQKSFLF
YEANRSGDLDESTKRIDWRGDSGLRDGRDGIYFGGQSSGNLQAGLSLDLTGGYHDAGDHG
KFGLPLASTLTTLAWGGVEFTDGYQTSGQMDDLLATIRWGTDYLLKAHVTNANGETVFFV
AQVGNASADHSLWSAPESQTIARPAMAVTANKPGSDVAAGSAAALAAASILFREAGDFAY
ADELLVNAQSLYRFADTYRGKYSDSIPEVRNYYNSWSGYEDELAYGAAWLSRAVNSAGGD
GSAYLQKALNIYNSDIGGLSRGWTHNWDDASYGVAVILAQDTGNQAIKQDVTRWLDAWVN
GTDGVQITDGGLRFISQWGSLRYAANTAMLAAVYSDGLTDPTGKYAQLAQDTVDYILGSN
PRNASYMVGYGNDFPQQPHHRAASGVGWDGFRNGLPNEHILFGALVGGPTAANDFSYNDS
RDDYISNEVAIDYNAGLTGALAWSVEQFGGNPLTAAQLNALPGISAPQGM
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgaatagcatcctttcccccattaccgtagcggtgggcggctccctctggtggaatggc
ttcaccgctgatttcaccatcaccaacacttctaccactagcctcagcaattggacttac
accttcgacactgtccacaaaatttccggtaatccctggggcgcaacttttaccagcgtg
gatttgggcaatggcatcacccgctacacattaactggggctggttgggcatcgagtatt
ccccccggtggttccgtcaccattggttttaatggtacccagggaacggcgatcggtaat
agcggctctttgacttctgctttattattcaccgacgttaatgccaatactggggggact
gggggagaacatcagcatccagatcctattcctcccacggatccagtcgtagatcccact
cctaaccccggcactggtagagtatttgctgccaatcctgcggccgccgatattgtcggt
ttcaatcccgctgtggataggttggattttggcgatgtgtcggtgcataacctcatcctt
ggtaaaaccagcaccgggaaagtggccatcattaatccctgggcttggactcctgagttt
cagattatccggggagttagctttgatgatttgacagcggccaattttggcattgtgcag
aacgagcatctgcggcaggacattggcggagtcctcagttgggaattaggtttaggggca
agaaatagtaatacggtttatgtccgttcccatgagtatggggtgcaggaacggatcgag
aattttaaccccgccaccatgaagttgagctttctctactacggcactagggaaagatta
accgttagcgatacgccggagggtttattaattgccacccaacccacgggacaaactttg
ttgctggtgggggtaacccgcagtcaactcattccggctaatttggaatttcaccatgac
caggtggtggaagaccgcttagaagatgcctttggggtcactgtcgagcaagttaccgtt
gttagtcgcactggtttagccactccccaggggccagcgggacaaattaccgatggtcat
cagagcaggcccggtaatggtttaactcccattggtggtggggaatttagcggcggtgct
gggggtcatggtagtggccatgatcacggtgaccatgaccatggcggcggtatggaccac
ggttctgatcccggtgatggcatggggggaggcactaccaatcctccggtcaccgatcca
gtcacgcccccacccaccgatcctgtttctcccactagtcctttcactgtcacggtggga
ggtaatcgttggtggaatggctttacggcggagttgactgtaactaacgtttcgggaact
aagcttaatagctggagctttacctttgatacggtgcataaaatttccggtagcccctgg
ggagccactgtccaaagtacagatttaggaggaggcattacccgttatgtggtcaccggc
agtgaatgggccgcttccattgcccctggcagttcggtcaaagttggctttaacggtacc
caaggaacggcgatcgccaacgacggggccttaaccgcagatttactctttctcggtggc
ggtatagttggtcaacccagcactggctctggtggtaatactggaggaactcccactaat
cccaatccccccactgaccccattaatcctaaccccaatcctgttgatcccgtcgatccc
ccggcgatcgccaatggggaccataattacggcgaagcgttgcaaaaatctttcctgttt
tacgaagccaaccgttctggagacttagacgaatccactaaacgcattgactggcgggga
gattccgggttaagggatggccgggatggcatttattttggtggacaaagtagcggtaat
ttacaagcaggtttaagcctggatttaaccggtggttatcatgatgcgggggaccacggc
aaatttggcttaccccttgcttccacattaaccaccctggcctggggcggcgtggaattt
acggacggttaccaaaccagtggccaaatggatgatctccttgcaaccatacggtggggg
acggactatctactcaaagctcacgttaccaacgccaatggagagacagtattttttgtc
gcccaggtgggtaacgcttcagcagatcattccctctggagtgccccggaaagccaaacc
attgcccggccagccatggcggttactgctaataaacctggttccgatgtggcggcgggt
tcagcggcggccctggcggcggcttctattctgttccgagaagcgggggattttgcctat
gcggatgaattgttagtcaatgcccaatctttatatcgatttgcggacacctaccggggt
aaatattccgactctattcccgaagtgcggaactattacaactcctggagtggctatgaa
gatgagttggcctatggggcagcgtggttgtcccgggcggttaatagtgcagggggggat
ggttctgcctatctgcaaaaggcattgaacatttacaacagtgacattgggggattgagt
cggggttggacccacaattgggacgatgcctcctatggtgtggcggtaatattagcccaa
gacaccggtaatcaagcgattaaacaagatgtgacccgctggctagatgcttgggtcaat
ggcaccgatggggtgcaaatcactgacggcggtttgcggtttattagccaatggggttcc
ctacgctacgcggccaatacggcaatgctggcagcggtctattccgacggcttaaccgat
cccactggtaagtatgcccagttagcccaggacacagtggactatattttaggcagtaat
ccccgcaatgctagctatatggtgggttacggcaatgattttccccaacagccccaccat
cgggcagcttcgggagtgggctgggacggtttccgcaacggcttgcccaatgagcatatt
ttgttcggtgctttggtgggcggtcccactgcggccaatgactttagttataacgactcc
cgggatgactacatcagcaacgaagtggccattgattacaatgcaggcttaacgggagca
ttggcttggtcggtggaacagtttgggggtaatcccctcacggcggcccagttgaatgct
ttacctggtatttcagcgccccaagggatgtag

DBGET integrated database retrieval system