KEGG   Synechocystis sp. PCC 6803: slr0909
Entry
slr0909           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Methyltransf_21 TFIIF_beta Methyltransf_11 FRG Phage_Mu_Gam
Other DBs
NCBI-ProteinID: BAA10460
CyanoBase: slr0909
CYORF: slr0909
UniProt: Q55375
Position
2784503..2785855
AA seq 450 aa
MIKQLLKNNRIVQRIKVLKDLFLQKLDDLQASVDQIKITTDQNLEEIRLELEQKNRNINQ
ILENQIFLIKSALDTARTIKYLVESGQQRQIIVEQMINAIHQEFQRIREESERSNGYIHQ
EFQNIRSESQQRYQLLHQEFQAVLGNLQHYQEILIDKFLDLQENSQQQDVFLRETLAQIA
ADVHDQKFKVVTDPSYFQAIDIELMVYLYSYLPHRRTIDVGANRGDVSARLLQTGYEVYA
FEPFPPVLAKLQERLGQNSNFHALGYALGSANETRNLHLVVDQTEDKIFDDATFYSSLTR
HSLTEGLVFHDSITVEVKTIASLHEAGTLPDDIGLVKIDTEGFDLEVIKGMGNFRYPVVL
AEFWDPTFPFGQTGAMNHLVDMVPAMRQRDYRWHIIIYRIWGQHEVSYYCNSDYSLENSW
GNVFFFQDYEIFSQALKWCNSVMPATYFAA
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgattaaacaattattaaaaaataatcgtatcgttcagagaatcaaggtattgaaagat
ctttttctacagaaattagatgacctccaggcaagtgttgaccaaattaaaataaccacc
gatcaaaacctggaagaaattagattagaattagagcaaaaaaatagaaatattaatcag
attttggaaaatcaaatatttctaattaagtctgccctcgatacagctagaaccattaaa
tatttagttgaaagtggacagcaaagacaaattattgtcgaacagatgattaatgctatc
catcaagaatttcaaagaattagggaagaatcagagaggagtaacggttatattcatcaa
gagtttcaaaatatcaggagcgaatcccagcaaaggtatcaactgctccaccaagagttc
caggctgttttgggtaatctgcagcactaccaagaaattttaattgataagttcttggat
ttacaggaaaacagccaacagcaagacgttttcttacgagaaaccctagctcagattgcc
gctgatgtccatgatcaaaaattcaaagtagtcaccgatcccagctatttccaggcgatc
gacattgagttgatggtttatctctactcttatcttccccaccgacggacgatcgatgtg
ggcgccaaccggggcgatgtctccgccagattgttacagactggctacgaagtttatgcc
tttgaacctttcccgccagtattagccaaattgcaggaaagattgggacaaaatagcaat
ttccatgctcttggctacgccctaggatccgccaatgagactaggaatttacacctagtg
gtggatcaaacggaagacaaaatctttgatgatgccactttttatagcagtttgactcgc
cattccctcactgaaggcttagtcttccatgacagtattacagtggaagtcaaaaccatc
gctagtttgcatgaagcgggaactctgcctgatgatattggcttagtcaaaattgataca
gaaggatttgacctagaagttattaagggcatgggaaattttcgttacccagtggtattg
gccgaattttgggatcccactttcccctttgggcaaaccggggccatgaaccatctagtg
gatatggtgccagctatgcgacaaagggattaccgctggcatataatcatctatcgcatc
tgggggcagcacgaggtcagttattactgcaactcggactattccttagaaaattcttgg
ggcaatgttttcttctttcaggattacgaaatctttagccaggctttaaaatggtgcaat
tcagttatgcccgccacctattttgcggcgtag

DBGET integrated database retrieval system