KEGG   Synechocystis sp. PCC 6803: slr0946
Entry
slr0946           CDS       T00004                                 
Symbol
arsC
Name
(GenBank) arsenate reductase
  KO
K03741  arsenate reductase (thioredoxin) [EC:1.20.4.4]
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    slr0946 (arsC)
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.4  arsenate reductase (thioredoxin)
     slr0946 (arsC)
SSDB
Motif
Pfam: LMWPc
Other DBs
NCBI-ProteinID: BAA18407
CyanoBase: slr0946
UniProt: P74313
Structure
Position
2012231..2012626
AA seq 131 aa
MKKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQ
TSDPIENFNADDYDVVISLCGCGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVK
ERVENLIAKIS
NT seq 396 nt   +upstreamnt  +downstreamnt
gtgaaaaaggtaatgttcgtttgcaaacgtaattcctgtcgctcccaaatggcagagggc
tttgccaaaactttaggggccggcaaaattgctgttaccagttgtggactggaatcttcc
cgggtccatcccaccgccattgccatgatggaagaagtaggcatagacatcagcggccag
acctccgaccccatcgaaaactttaacgccgacgattacgacgtggtaatttccctttgt
ggctgtggggttaatctgccgccggaatgggtaacccaggaaatttttgaagactggcaa
ctggaagatcccgatggtcaatcattggaagtttttcgcaccgtgcggggccaggttaag
gaacgggtggaaaacctgatcgccaaaattagctga

DBGET integrated database retrieval system