KEGG   Synechocystis sp. PCC 6803: slr0947
Entry
slr0947           CDS       T00004                                 
Name
(GenBank) OmpR subfamily
  KO
K11329  two-component system, OmpR family, response regulator RpaB
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:syn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    slr0947
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:syn02022]
    slr0947
Two-component system [BR:syn02022]
 OmpR family
  SasA-RpaAB (circadian timing mediating)
   slr0947
SSDB
Motif
Pfam: Response_reg Trans_reg_C MTD
Other DBs
NCBI-ProteinID: BAA18408
CyanoBase: slr0947
UniProt: P74314
Position
2012781..2013485
AA seq 234 aa
MVDDEASIRRILETRLSMIGYEVVTAADGEEAIATFHESDPDLVVLDVMMPKLDGYGVCQ
ELRKESDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRVDKNGMP
GIPSSGVLQIATIRIDTNKRQVYKGDERIRLTGMEFSLLELLVSRSGEPFSRSEILQEVW
GYTPERHVDTRVVDVHISRLRAKLEEDPSNPELILTARGTGYLFQRILEPGEEP
NT seq 705 nt   +upstreamnt  +downstreamnt
gtggtcgatgacgaggccagcatccgacgcatactggaaacccgtttatccatgattggc
tatgaagtggtgaccgctgccgacggtgaagaggcgatcgccactttccatgagagcgac
cccgatttggtggtgttggatgtgatgatgcccaagctggacggctacggcgtttgccaa
gaactacgtaaagaatcggacattcccattattatgcttaccgccctgggggatgtggcc
gatcgcattaccggtttggaactgggggccgatgattatgtggtgaagcccttttccccc
aaggaattggaagctagaatccggtccgtgctacggcgggtggacaaaaacggtatgccg
ggcattcccagttcgggcgtgttgcaaattgccaccattcgcattgataccaacaagcgt
caagtgtataaaggggatgagcgcatccgcctaacaggaatggaatttagcctgttggaa
ttgttggtgagtcgctccggagagcccttttcccgttcggaaattctccaggaagtgtgg
ggctacacccccgaacgccatgtggataccagggtggtggacgtgcatatttcccgcctg
cgggccaaactagaggaagaccccagcaatcccgaattaattcttactgcccggggcacc
ggttacctgttccaacgcattctggaaccgggggaagaaccgtaa

DBGET integrated database retrieval system