KEGG   Synechocystis sp. PCC 6803: slr0948
Entry
slr0948           CDS       T00004                                 
Name
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: CCB2_CCB4 GAF_2 TspO_MBR
Other DBs
NCBI-ProteinID: BAA18409
CyanoBase: slr0948
UniProt: P74315
Position
2013538..2014185
AA seq 215 aa
MSADPNRIVRLLPLGAGSLGGLLLLINRLSTPMLNPSQARSDVVGVILAGMLVCVWLIWQ
RIQPKSPEAVVLEGKEGFDLLDSLPQEIKTELAWASHLLLTNTVTQTMVVYYDRQVLLRR
GILSEQKEVKPGPIVERVMQTQKPVYLVNLPLYPGRVEFDYLPANTQGLICQPLDDRGVL
ILGANIPRSYTKQDENWVTGIADKIAHSLSMPINA
NT seq 648 nt   +upstreamnt  +downstreamnt
atgagtgcagatcccaatcgtattgttcgtttattaccccttggggcgggcagtctcggg
ggactgttattgctaattaaccgcctttccacccccatgttaaacccttcccaagcccgt
tccgatgtggtgggggtaattttggcggggatgctggtgtgtgtctggctaatttggcaa
cggattcagcccaagtccccggaagcggtggtgctagaaggcaaagaaggctttgattta
ctggatagtctgccccaggaaataaaaacagagttagcttgggcttcccatttgctcttg
actaatacggtcacccaaaccatggtggtctattacgatcgccaggtgttattgcgccgg
ggcattttgagtgagcaaaaagaagtgaaaccggggccgattgtagaacgggtaatgcaa
acccaaaagcccgtttatttggtgaatttacccctctatcccggtcgagtggaatttgat
tatttacccgccaacacccagggtttaatctgtcagcccctcgacgatcggggtgtgtta
atcctaggagccaatattccccgcagttatacgaaacaggatgaaaattgggtcacgggc
attgctgataaaattgcccatagcttgagcatgcccatcaatgcttaa

DBGET integrated database retrieval system