KEGG   Synechocystis sp. PCC 6803: slr0949
Entry
slr0949           CDS       T00004                                 

Symbol
livH
Name
(GenBank) high-affinity branched-chain amino acid transport permease protein
  KO
K11956  neutral amino acid transport system permease protein
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:syn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    slr0949 (livH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    slr0949 (livH)
Transporters [BR:syn02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Neutral amino acid transporter
    slr0949 (livH)
SSDB
Motif
Pfam: BPD_transp_2
Other DBs
NCBI-ProteinID: BAA18412
CyanoBase: slr0949
CYORF: slr0949
UniProt: P74318
Position
2017104..2017964
AA seq 286 aa
MDLSQLIFNGIAVGSIIALGAVGLTLTYGILRLSNFAHGDFMTLAAYLTWWANTSGINLW
LSMALGCVGTIIAMFIGEWLLWKPMRARRATATTLIIISIGLALFLRNGILLIWGGNNQN
YRVPIVPAQDFMGIKFEYYRLLVIAMAIAAMVVLHLILQRTKVGKAMRAVADNVDLAKVS
GINVEWVVMWTWVMTAVLTALGGSMYGLMTTLKPNMGWFLILPMFASVILGGIGNPYGAI
AGGIIIGVAQEVSVPWFGTSYKMGVALLLMIIILFIRPQGLFKGTQ
NT seq 861 nt   +upstreamnt  +downstreamnt
atggatctatcacagttaatctttaatggcattgcggtgggaagcattatcgccctgggg
gcagtggggttgaccctgacctatggcattttacgcctgtctaattttgcccatggtgat
tttatgactttggcggcctatttaacttggtgggccaacaccagcggcattaatttgtgg
ttatccatggccctgggttgtgtcggtaccatcattgccatgttcattggtgaatggttg
ctctggaagcccatgcgggcccggcgggctacggcaacaacgctgatcattatttccatt
ggtctagccctatttctccgcaacggcatcctcttgatctggggtggcaataaccaaaat
taccgagtgcccattgtccctgcccaggattttatgggcattaaatttgagtattaccgt
ctactggtcattgctatggcgatcgccgccatggtggtgttgcatttgattttgcaaagg
acgaaagtgggcaaagcgatgcgggccgtggcggacaatgttgatctggcgaaagtatcc
ggcatcaacgtggaatgggtagtgatgtggacctgggtaatgaccgcagtgttaacagcc
ctaggaggatccatgtatggcctgatgaccaccctgaaaccgaatatggggtggtttttg
attttgcccatgtttgcttcggtgattctagggggcattggtaatccctacggggcgatc
gccggggggataattattggcgtagcccaggaagtgagcgtgccttggtttggcaccagt
tacaaaatgggggtggcattgctgttgatgatcatcattttgttcattcgtccccaaggt
ttgtttaaaggcactcaataa

DBGET integrated database retrieval system