KEGG   Synechocystis sp. PCC 6803: slr0950
Entry
slr0950           CDS       T00004                                 
Name
(GenBank) hypothetical protein
  KO
K06442  23S rRNA (cytidine1920-2'-O)/16S rRNA (cytidine1409-2'-O)-methyltransferase [EC:2.1.1.226 2.1.1.227]
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:syn03009]
    slr0950
Enzymes [BR:syn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.226  23S rRNA (cytidine1920-2'-O)-methyltransferase
     slr0950
    2.1.1.227  16S rRNA (cytidine1409-2'-O)-methyltransferase
     slr0950
Ribosome biogenesis [BR:syn03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    slr0950
   23S rRNA modification factors
    slr0950
SSDB
Motif
Pfam: FtsJ S4 S4_2
Other DBs
NCBI-ProteinID: BAA18413
CyanoBase: slr0950
UniProt: P74319
Position
2017964..2018788
AA seq 274 aa
MAKADKQRLDALLVAKGLCESRALAQRLIRAGEVKVNQQLVDKPGTLVTMDVAVELAQRP
PYVSRGGEKLAKALTEFAIDVTGRICLDGGISTGGFTDCLLQRGATKVYGVDVGYGQVAW
KLRQDDRVILRERANFRYLTPQDLYGDQPWPDLGVMDLSFISLTKVMAPLWSLLAPPREV
VLLVKPQFEVGREKIGKKGVVRDAQAQAEAIDQVWRSGQSLGWQFNGLTFSPITGPAGNV
EYLLWLSQSAVNASAPTLAQLGEITQKTLDSFRN
NT seq 825 nt   +upstreamnt  +downstreamnt
atggccaaagcagataaacaacgactggatgcccttttggtagccaaaggtttatgtgaa
tccagagccctggcccagcggttgatccgggcgggggaagtgaaagttaatcaacagttg
gtggataaaccaggcaccctggtaaccatggatgtggcggtggaactagcccaaaggcct
ccctacgtttcccggggaggggaaaagttagccaaggccctaacggaatttgccattgat
gtgaccggtcgcatttgtctcgatgggggcatttccactggtggctttacggattgttta
ttacaaaggggagcaacgaaggtttacggcgtggatgtgggttacggccaggtggcttgg
aaattgcgtcaggatgaccgggtgattttgcgggagcgggccaattttcgttacctcacg
ccccaggatttgtatggggatcaaccctggccggacttgggggtgatggatttgtccttt
atttcccttaccaaagtgatggctcccctctggtctctcctcgctcctccccgggaagtg
gtgttattggttaagccgcaatttgaagtgggcagggaaaaaattggcaaaaagggagtg
gtgcgggatgcccaagcccaggcagaggccattgaccaagtgtggcgatcagggcagagc
ctcggttggcagtttaacggtttaactttttcccctatcaccgggccggcgggcaatgtg
gaatatttactctggctcagtcaatccgctgttaacgcctctgctccaacgctagctcag
ttgggggaaattacccaaaaaacgttggattcttttagaaactga

DBGET integrated database retrieval system