KEGG   Synechocystis sp. PCC 6803: slr0951
Entry
slr0951           CDS       T00004                                 
Name
(GenBank) hypothetical protein
  KO
K00991  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC:2.7.7.60]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00900  Terpenoid backbone biosynthesis
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
Module
syn_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    slr0951
Enzymes [BR:syn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.60  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
     slr0951
SSDB
Motif
Pfam: IspD NTP_transf_3 CTP_transf_3 DpaA_N TruB_C
Other DBs
NCBI-ProteinID: BAA18417
CyanoBase: slr0951
UniProt: P74323
Position
2021252..2021944
AA seq 230 aa
MHLLIPAAGSGKRMGSGHNKLLLNVLGQPLLSWTVQAALASQSIEWIGIMGQPYDFPAFE
ALLTPLHSPKPVQLIVGGDTRQQSVFNGIQALPPGAKFVLIHDGARCLATPDLFDRCTEA
LQHCQGLIAAMPVKDTIKIVNADGWITDTPDRQGLWGAQTPQGFDVALLKACHDKGKQEG
WEVTDDAALLEKCGQPVKIVPGEDTNLKITTPVDLAIAEFILGQRSAKSA
NT seq 693 nt   +upstreamnt  +downstreamnt
atgcatttactaattccagcggcgggttccggcaaacggatggggagcggtcacaataag
ttacttttaaatgttttggggcaacccctgctgagttggacagtgcaggcggcattggca
tcccagtccattgagtggattggcatcatgggccaaccctacgattttccagcctttgaa
gctctattaactcccctccatagccctaaaccagtgcagttaattgtggggggagatacc
cgacaacaatcggtttttaatggcatccaagctctgcccccgggggcgaaatttgtgtta
atccacgacggtgcccgttgtttggctacgccggatttgtttgatcgttgcacagaggct
ctccagcattgccaaggattaattgccgccatgccagtgaaggacaccatcaaaatagtt
aacgctgatggttggatcactgacacccccgatcgccaaggattgtggggagcccaaacg
ccccagggttttgacgtggccctgctcaaagcctgccatgacaaaggtaaacaggaaggt
tgggaagtaacggatgatgcggccctgctggaaaaatgtgggcaacccgtgaaaatagtg
ccaggggaagatactaacttgaaaattaccacccccgtagatttggcgatcgccgaattt
attttggggcagaggtcggcaaaatccgcctga

DBGET integrated database retrieval system