KEGG   Synechocystis sp. PCC 6803: slr1218
Entry
slr1218           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: DUF4168
Other DBs
NCBI-ProteinID: BAA17501
CyanoBase: slr1218
CYORF: slr1218
UniProt: P73461
Position
1018650..1019126
AA seq 158 aa
MVISSRPLSGLNGVLSRLFIANTLAFLGLFGGMVPEVSWHPTALVFRWSAYSQEFSPESI
NHYAKAVLAIEVERKKAFEEIQTLIGRVPPQLTCTNRDSIRKLPRNAQAIAVNFCNRSKQ
IAEESGLKPGEFNRITEAAKNNANLKTQIQRAIINLRR
NT seq 477 nt   +upstreamnt  +downstreamnt
atggttattagctcacgtcccttaagcggcttgaacggtgttctgagtcgactttttatt
gccaatactctcgccttcctcggcttatttgggggaatggtgccggaggtaagttggcac
cccacagcccttgtctttcgctggtcggcctattcccaggaattttcccccgagagcatc
aatcactatgctaaggcagtattagccattgaagtagaacggaaaaaagcctttgaggaa
attcaaaccctcattggccgggttcccccccaacttacctgcaccaatcgggacagtatc
cgcaagttaccccgcaacgcccaggcgatcgccgttaatttttgcaatcgttccaaacaa
attgctgaagaaagcggactcaagccgggagaatttaatcgcatcaccgaagccgccaag
aataatgccaacctgaaaacccaaattcaacgggcaatcattaatctccgccgttag

DBGET integrated database retrieval system