KEGG   Synechocystis sp. PCC 6803: slr1220
Entry
slr1220           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: PRC DUF3236
Other DBs
NCBI-ProteinID: BAA17503
CyanoBase: slr1220
CYORF: slr1220
UniProt: P73463
Position
1019808..1020761
AA seq 317 aa
MTIDNIRLRNEFINTEVITRSSGKKLGVVKEVLVDVDQREIVALGLRDNFLSLTGMPQYL
YLNSIVQTGDVVLVENDDVFELVEVDLYSPLVNSEVVTETGEPLGRVRDFQFDLATGKVS
SIIIASLGLPQIPDQLISTYELSIDEVVSSGPNRLIVFEGAEERLNQLSVGLLERLGIGR
PSWERMEEDLYYPPTTRPENQLGSGIPVRPPVQVRQPEPVLEERWNEDDWQDTRPAPPPR
REVAPLRYPEPEYEDDYEVDNWGEASSRSSAPEPDYDYEDGVAGDVWDDDEAPAPYSPPR
VNIPETRREKMPEYYEE
NT seq 954 nt   +upstreamnt  +downstreamnt
atgaccattgataacatccgtcttagaaacgaatttattaacaccgaagttattacccgc
agcagcggcaaaaaactgggggtagtcaaagaagtgctagtcgatgtcgatcagcgagaa
attgtcgccctgggactgcgggacaactttttgtctttaaccgggatgccccaatatctt
tacctgaacagtattgtccaaaccggggacgtggtcttagtagaaaacgatgatgttttt
gaattggtggaagtggacctctattcccctctggtcaatagcgaagtggttactgaaacg
ggagaacccctgggtagggtaagggattttcagtttgacctcgccactggcaaagtttcc
tccattatcatcgcttccttgggattaccccaaattcctgaccaacttatcagcacctac
gagctttccattgacgaggtggtgagcagtggtcccaaccgtttgatcgtttttgaagga
gcagaggaaagattaaatcaactcagtgtgggattactggaacgccttggcattggccgt
ccttcttgggaacggatggaagaggatttgtattatccccccactacccgccctgaaaat
caattgggcagtggcatccccgtgcggccaccggtacaagtccgtcaaccggagcccgtg
ttggaagagcgttggaacgaggacgattggcaagatacccgccctgcgccgccccctcgt
cgggaagtggcccctctgcgttatccagagccggaatatgaagatgattatgaagtggat
aattggggggaagcgtcttcccgttcttctgctccagaaccggattatgattatgaagat
ggagtggctggcgatgtctgggacgacgatgaggcccctgctccctacagccctccccgg
gtgaatattccggaaacccgccgggaaaaaatgcctgaatattatgaagaatag

DBGET integrated database retrieval system