KEGG   Synechocystis sp. PCC 6803: slr1230
Entry
slr1230           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Usp Ribonuc_L-PSP AAA_31 DUF3585
Other DBs
NCBI-ProteinID: BAA17515
CyanoBase: slr1230
CYORF: slr1230
UniProt: P73475
Position
1037189..1038052
AA seq 287 aa
MKNILLCTDGSDFAQQSYPYAAWLASKLGGNIKVLYVTDIRAQKAVESVNLSGSIGLGTS
EELLKQLVDLEHTKAKLNHQKAKLVLATAKNTLQQAGIESVQVMHKTGFLLDCLEDLKGD
FDVIILGKRGETAKFAQGHLGANMERIIRSIPKPCLVTPKQFQTITKVLFAYDGSASCQK
ILQFLAGSSLLADLPLHIVTVGKTNQDPQAIANLGTAEKVLEKAGFKLEVELLVGHAEEA
IVRYQEDNAIDLLLMGAHGHSRIRHLVIGSTTAQVLRKTSIPVLTFR
NT seq 864 nt   +upstreamnt  +downstreamnt
gtgaaaaatattttgctttgcactgatggatcggatttcgctcagcaaagttatccctac
gccgcctggttagccagtaaattaggcggcaatatcaaggttttatacgttactgatatc
cgggcccaaaaggcagtggaatcggtcaatttgagtggcagtattggcttaggaacttct
gaagaattattaaaacaattggtggatttagaacatactaaagccaaacttaatcatcaa
aaggcgaaactggtcctggcaacggctaaaaacactctccagcaagctggcatagaatcg
gtgcaggttatgcacaaaacaggttttttattggattgtctagaagatttgaagggcgat
tttgatgtaattatcctggggaaaagaggggaaacagctaaatttgcccagggccatttg
ggagccaatatggagagaattattcgcagtattcccaagccctgtttggttactccaaag
cagtttcaaaccattaccaaagttctttttgcctatgacggtagtgccagttgccaaaaa
attctgcagtttttggccggttcctccctgttggctgatttgcccctacacattgtcacg
gtggggaaaaccaaccaagacccccaggcgatcgccaatttgggtacagccgaaaaagtc
ttggaaaaagctggttttaagctcgaggtggaattgttggtgggccatgcggaagaagcc
attgttcgttaccaggaagataacgccattgatttattgttaatgggggcccatggccat
agccgtattcgccatttggttatcggtagtaccaccgcccaagttctacgaaaaacttcc
attccggttctaacctttcgctag

DBGET integrated database retrieval system