KEGG   Synechocystis sp. PCC 6803: slr1232
Entry
slr1232           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: SH3_3 SH3_4 SH3_16
Other DBs
NCBI-ProteinID: BAA17517
CyanoBase: slr1232
CYORF: slr1232
UniProt: P73477
Position
1039196..1039732
AA seq 178 aa
MKGHINAPEKVSPHRILKLFNLMAVFGLLGQGFWLQAPALGQNALTVCGAETGRVYLRDR
PSNASQNANRTLANGTPVRGYEYRNGFVFVETVNGFSGWVTERYLCGSSPVGSSPSYICG
AETGRVYLRDRPSNSSQNANRTLSNGTAVSTEGYSNGFFLVETMDGMRGWVTERYVCP
NT seq 537 nt   +upstreamnt  +downstreamnt
atgaaaggtcacatcaatgctccggaaaaagtttctccccaccgtatcttgaaactcttt
aacttgatggccgtgtttggtctgttggggcaaggtttttggttgcaagcccctgccttg
ggccaaaatgctctcaccgtctgtggggcagaaaccggcagggtctatttacgggatcgt
cctagcaatgctagtcaaaatgctaaccgcaccctagccaacggcacccctgtgcgagga
tacgaatatcgcaacggctttgtttttgtggaaaccgtcaatggtttttcggggtgggtc
acagaacgctatctttgtggcagttcccccgttggaagttccccttcctatatctgtggt
gccgaaacgggacgggtatatttgcgcgatcgccccagcaatagcagccaaaatgccaac
cgcaccctgagcaatggcactgcagttagtaccgagggttatagcaacggtttcttcctg
gtggaaaccatggacggcatgagaggctgggtgacagagcgttatgtttgtccttga

DBGET integrated database retrieval system