KEGG   Synechocystis sp. PCC 6803: slr1234Help
Entry
slr1234           CDS       T00004                                 

Definition
(GenBank) protein kinase C inhibitor
  KO
K02503  histidine triad (HIT) family protein
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:syn04147]
    slr1234
Exosome [BR:syn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   slr1234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HIT DcpS_C
Motif
Other DBs
NCBI-ProteinID: BAA17521
CyanoBase: slr1234
CYORF: slr1234
UniProt: P73481
Position
1042609..1042953
Genome map
AA seq 114 aa AA seqDB search
MAEDTIFSKIIRREIPAAIVYEDDLCLAFKDVNPQAPVHVLLIPKKPLPQLSAATPEDHA
LLGHLLLKAKEVAADLGIGDQFRLVINNGAEVGQTVFHLHLHILGGRPFSWPPG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagataccattttcagtaaaattatccgtcgggaaattccagcggcgatcgtc
tatgaagatgatctttgcctagctttcaaggatgttaatccccaagcgccagtccatgtg
cttttaatccccaaaaagcctttaccccaattgtcagcggccaccccggaagaccatgcc
ctactgggtcatcttttgctcaaagccaaggaagtagcggcggatctaggcattggcgat
caatttcgcttagtcattaataacggggcggaagtggggcaaactgtgttccatctccac
ctccatatccttggcggtcgcccttttagctggcctccgggttaa

DBGET integrated database retrieval system