KEGG   Synechocystis sp. PCC 6803: slr1239
Entry
slr1239           CDS       T00004                                 

Gene name
pntA
Definition
(GenBank) pyridine nucleotide transhydrogenase alpha subunit
  KO
K00324  H+-translocating NAD(P) transhydrogenase subunit alpha [EC:1.6.1.2 7.1.1.1]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00760  Nicotinate and nicotinamide metabolism
syn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    slr1239 (pntA)
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.2  NAD(P)+ transhydrogenase (Re/Si-specific)
     slr1239 (pntA)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.1  proton-translocating NAD(P)+ transhydrogenase
     slr1239 (pntA)
SSDB
Motif
Pfam: AlaDh_PNT_C AlaDh_PNT_N PNTB_4TM DUF3392 2-Hacid_dh_C Pyr_redox_2
Other DBs
NCBI-ProteinID: BAA17536
CyanoBase: slr1239
CYORF: slr1239
UniProt: P73496
Position
1053955..1055547
AA seq 530 aa
MTIAAPKTTVAPEMKPTTPKKIGVPRESFDQECRVAMTPDTAQKLQKLGFDLLLETGAGA
KADFADRLYESLGCGIVDGRQTLFEQADIILKVRPPSPAEVEELPAGKALISFIWPAQNP
ELLEKLAAKNITVLAMDAVPRISRAQKLDALSSMANIAGYRAIIEAANRFGRFFTGQITA
AGKVPPAKVLVIGAGVAGLAAIGAAKSLGAIVRAFDTRPVVKEQVESLGGEFLLLDFKED
GTGQGGYAKVMSEEFIAAEMALFAAQAKEVDIIITTALIPGRPAPKLITEPMVKSMRAGS
VVVDLAAEQGGNCEVTKPGEVYEYEGVTIIGYTDLPSRMASQSSQLYGTNLWHLLKDMGG
SEAFKVDVEDEVIRGALVSHEGKITWPPPKLNPPSPVQPAKPTVTVVESEAKSAKKSGSG
NFLWLALAAIALVGIGIGAPTSFLSHFTVFVLACVVGWQLIWNVAPALHTPLMSVTNAIS
GIIIIGGMLQISGPLNSPTTILGAIAILVGTINIAGGFLVTQRMLKMFRK
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgaccattgccgcccctaaaaccaccgttgcccctgagatgaagccgacgacaccgaaa
aaaattggtgtacccagggaatcctttgaccaggaatgccgggtggccatgacccccgat
acagcccaaaagctgcaaaaattgggctttgatttgttgttggaaacgggagcgggagca
aaagcggatttcgccgatcgcctttatgagtccctaggctgtggcattgtcgatggtcgc
caaaccttatttgagcaagcggacattatcctcaaagtgcggcccccttccccggcagag
gtggaggagttaccggcggggaaagccctgattagttttatctggccggcccaaaatccc
gaattgctggaaaaattggcggcgaaaaatatcactgtgctggcgatggatgcggtgccc
cggatcagtcgggcccagaaattggatgccctcagttccatggccaacattgccggttac
cgggcgatcattgaagcggctaatcgttttgggcggtttttcactggacagatcactgcg
gcgggcaaagttcccccagcaaaagttctggtcattggggccggggtagcagggttagcg
gcgatcggggcggccaaaagcttaggggcgatcgtgcgggcctttgatactcgcccagtg
gtcaaagaacaggtggaaagtttaggcggggaatttctcctgctggactttaaggaagac
ggcaccgggcaggggggttacgccaaagtaatgagtgaagaattcattgcggcggaaatg
gcgttatttgccgcccaagccaaggaagtggacattattatcaccacagcgttgattccc
ggtcgtcccgcccccaaattgattactgaacccatggtcaaatccatgcgggctggttcc
gtagtggtggacttagcggcggagcaggggggcaactgtgaagttactaaacccggcgaa
gtttatgaatatgaaggggtgaccatcattggctacactgatttgcccagtcgcatggcc
agtcaatccagtcagctttacggcaccaatctctggcatttgctcaaggatatgggcggc
tccgaagctttcaaagtggatgtggaagatgaggttattcggggagccttggtatcccat
gaaggcaagattacttggccaccgccgaagcttaatccccctagtccggtgcaaccagct
aaacctaccgtgaccgtagtggagagtgaagccaaatctgctaaaaaatccggctccggt
aattttctttggttagccctagcggcgatcgccttggtgggcattggtatcggcgcacct
acttcttttctctcccatttcactgtgtttgtgctggcctgtgtggtgggttggcagtta
atttggaatgtggccccggcattgcacacccctttgatgagtgtgaccaacgccatcagc
ggcatcatcattatcggtggcatgttgcagatttccgggccattgaatagtcccaccact
atcttgggggcgatcgccattttagtgggaacgatcaacattgccgggggatttttagtt
acccaacggatgctgaaaatgtttcggaagtaa

DBGET integrated database retrieval system