KEGG   Synechocystis sp. PCC 6803: slr1241
Entry
slr1241           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
  KO
K07075  uncharacterized protein
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    slr1241
SSDB
Motif
Pfam: NTP_transf_2 Polbeta
Other DBs
NCBI-ProteinID: BAA17538
CyanoBase: slr1241
CYORF: slr1241
UniProt: P73498
Position
1056119..1056466
AA seq 115 aa
MQISPAFKYKVSIDPGKITAFCQQWQITELALFGSFLRDDFDLDNSDIDVLVSFEPNVPW
TILDLVDMEDQLQQIFGRKVDLMERLSIEQSQNPLRKKAILESLQVIYTESRLQI
NT seq 348 nt   +upstreamnt  +downstreamnt
atgcaaatttccccagcatttaaatataaagtttccattgatccaggcaaaattactgca
ttttgtcagcaatggcaaataactgagcttgccctatttggttcatttctccgagatgat
tttgatctagataacagcgacattgacgttttggtctcttttgagcctaatgttccctgg
acaatcttagatctggtggatatggaagatcaacttcaacaaatttttggtcggaaggtg
gacttaatggaacggttaagcattgagcaaagccaaaatccactgaggaaaaaagcaatt
ttggaatctttacaggtcatttatacggagtcgagactacagatttag

DBGET integrated database retrieval system