KEGG   Synechocystis sp. PCC 6803: slr1257
Entry
slr1257           CDS       T00004                                 

Name
(GenBank) unknown protein
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    slr1257
Transporters [BR:syn02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    slr1257
SSDB
Motif
Pfam: SBP_bac_3 Ion_trans_2 Lig_chan Lig_chan-Glu_bd Ion_trans
Other DBs
NCBI-ProteinID: BAA17851
CyanoBase: slr1257
CYORF: slr1257
UniProt: P73797
Structure
PDB: 
1II5 1IIT 1IIW

Position
1401809..1403002
AA seq 397 aa
MLILRRLILVVSLSFATIAIDITTRPGLEPVQGQGVETVDSQTLKVGVVGNPPFVFYGEG
KNAAFTGISLDVWRAVAESQKWNSEYVRQNSISAGITAVAEGELDILIGPISVTPERAAI
EGITFTQPYFSSGIGLLIPGKPVSLWERFSPFFGIAALSSAGVLTLLLFLVGNLIWLAEH
RKNPEQFSPHYPEGVQNGMWFALVTLTTVGYGDRSPRTKLGQLVAGVWMLVALLSFSSIT
AGLASAFSTALSEASATPLFRSVGDLKNKEVAVVRDTTAVDWANFYQADVRETNNLTAAI
TLLQKKQVEAVMFDRPALIYYTRQNPNLNLEVTEIRVSLEPYGFVLKENSPLQKTINVEM
LNLLYSRVIAEFTERWLGPGIEENQDLLPQNIGESPS
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgttaatcctgcgtcgcctaatactagttgtttcccttagttttgccacgatcgccatt
gacattactacgagaccagggctggaaccagtgcaaggccagggggtggagacagtagac
tcgcaaacactaaaagtgggggtggtgggcaatcctccctttgtcttttatggagaagga
aaaaacgcagcatttaccggtattagcctagatgtgtggagagcagtggccgagtcccag
aagtggaattcagaatatgtaaggcaaaattccatctccgcaggcatcacagcggtggcg
gaaggggaattggatattttaattggtcccattagtgttaccccagagcgggccgccata
gagggcattaccttcacccagccctatttcagtagtggcattggcctgttaattccaggc
aaaccggtgagtttatgggaaagattttcgcctttttttggcatagccgctttgtcttca
gcgggggtacttactctacttttatttttggtggggaatttaatttggttagcagaacat
cgcaaaaatcctgagcagttttccccccattacccagaaggagtccaaaatggcatgtgg
tttgccttagttaccctaacaacagtgggctatggcgatcgatcgccgaggactaagtta
gggcaactggtggcgggggtatggatgttggtggccttattaagtttttcttccattacg
gcggggttagcttcggctttttccacggctctttccgaagctagtgcaacacctttgttt
agaagtgtgggggatttgaaaaataaagaggtggcagtggtgcgggataccacagcggtg
gattgggctaatttttatcaggctgacgttagggaaactaataatttgacagcagccatt
accctactacaaaaaaaacaggtggaggcggtaatgttcgaccggccagccttaatttac
tacaccagacagaatcctaatcttaacttggaggtgacagaaattcgagtttccctggag
ccctatggctttgtgctcaaggaaaatagtcctttgcaaaagactatcaatgtggagatg
ctcaatttgctttacagcagggtaattgcggaatttaccgaacgctggttagggcctggg
attgaggaaaatcaagaccttttgccccaaaacataggagaaagccctagctaa

DBGET integrated database retrieval system