KEGG   Synechocystis sp. PCC 6803: slr1269Help
Entry
slr1269           CDS       T00004                                 

Gene name
ggt
Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00430  Taurine and hypotaurine metabolism
syn00460  Cyanoamino acid metabolism
syn00480  Glutathione metabolism
syn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    slr1269 (ggt)
   00460 Cyanoamino acid metabolism
    slr1269 (ggt)
   00480 Glutathione metabolism
    slr1269 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:syn01002]
    slr1269 (ggt)
Enzymes [BR:syn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     slr1269 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     slr1269 (ggt)
Peptidases and inhibitors [BR:syn01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   slr1269 (ggt)
CD molecules [BR:syn04090]
 Proteins
  slr1269 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: BAA18270
CyanoBase: slr1269
CYORF: slr1269
UniProt: P74181
Position
1859816..1861372
Genome map
AA seq 518 aa AA seqDB search
MAGKTTGVVAAGHAQTAEAGKCMLEEGGNAFDAAIASVLAACVVESSLTSLGGGGFLLAQ
TAAKKSYLFDFFCQTPQVNPGEKAVDFYPVALNFGGAWQTFHIGKGAIAVPGMVAGLFAA
HRKLGQLPFKVLIEPAVAYARQGFTLNRFNDFTNGLLEPILTQQEEGRKFYAPQGKILRQ
GEKAYLPQFADVLEQLARHGPDWFYRGELTEWVLESLGEASALTAKDWADYQVEIRLPLR
AQYRQRQLLTNPPPSAGGILIAFALQLLEKYDLSQYPLGSAAQIQLFSQVMALSNQARRQ
YLDGNLHCGDIEAKFLGGDRLASELGQSKFINKLGSTTHISVLDGEGNAASLTSSNGEGS
GHFIPGTGIMLNNMLGEEDLNPQGFYQWPPGQRLSSMMAPTILLDQEQPRLVLGSGGSNR
IRSAILQVVCHHLDYQLPLAEAVGRERIHWEAHKLDLEPTSVADILAQLRFDDGTQGTLW
TEQNMFFGGVHGVATTTAGTMEGVGDPRRSGAVAYSLE
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtaaaaccactggggttgtggcggcgggccatgcccaaacggcagaagcgggc
aaatgtatgctcgaagaagggggcaatgccttcgatgcggcgatcgcctcggtgttggcg
gcctgcgtagtggaatcgagtttaacttccctggggggagggggttttctgctggcccag
acggcggcgaagaagagttacctgttcgattttttctgccaaacaccccaagttaaccca
ggggaaaaagcagtggacttctaccccgttgccctcaattttggtggagcttggcaaact
tttcacattggtaaaggggcgatcgccgtgccggggatggtggcgggattatttgcggcc
cataggaaactggggcagctacctttcaaagtattgattgaaccagcggtggcatatgcc
cgccagggatttaccctcaaccgtttcaatgactttaccaatggtctgctggagccaatt
ctgacccaacaagaggaaggcagaaagttttacgctccccaaggaaaaattctccgccaa
ggggaaaaggcctatctgccccagtttgcggacgtgctggaacaattggctcgccatggc
ccggattggttttaccggggagagttaaccgagtgggtgctggaatctttgggggaagcc
agtgctctgaccgccaaggactgggccgactatcaggtggaaattcgtctacccctgcgg
gcccaatatcgccaacggcaactgttaaccaatcctccccccagtgccggaggcattctc
attgcttttgctttgcagttgctagaaaaatacgatttgagccaatatcccctgggcagt
gcggcacaaattcagctttttagccaagtgatggccctgagtaaccaagcccgtcggcaa
tatttagatggcaatctccactgtggggacattgaagcaaaatttctcggcggcgatcgc
ctggcctcggaactaggacaatcaaaatttatcaataaattgggtagcaccacccacatc
agtgttttagacggagagggcaatgccgccagcttaaccagttccaatggggaggggtct
gggcattttattcccggcacgggcattatgctgaacaacatgttgggggaagaagacctc
aatccccagggcttttaccaatggccaccggggcaacgcctatcatcgatgatggccccc
actatacttttagaccaggaacaaccccggctagttttggggtcagggggatcaaatcgc
attcgtagtgccattttgcaggtggtctgtcatcacctagattaccaattacccttagcc
gaagcggtggggcgggaacgtattcattgggaggcccataaattagatttggagccaacc
tctgtagctgatattctggcccagttgcgatttgacgacggcacccagggtaccctttgg
acggaacaaaatatgttttttgggggagttcatggggttgccaccaccactgcggggacc
atggaaggggttggagatccccggcgatcgggggccgtggcctacagtctggaataa

DBGET integrated database retrieval system