KEGG   Synechocystis sp. PCC 6803: slr1336
Entry
slr1336           CDS       T00004                                 

Name
(GenBank) H+/Ca2+ exchanger
  KO
K07300  Ca2+:H+ antiporter
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    slr1336
Transporters [BR:syn02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   slr1336
SSDB
Motif
Pfam: Na_Ca_ex WS_DGAT_C
Other DBs
NCBI-ProteinID: BAA18148
CyanoBase: slr1336
CYORF: slr1336
UniProt: P74072
Position
1723452..1724570
AA seq 372 aa
MSTKSKIFLVLLVFCPLSFAAHWLGWGETTVFILAGLAIVPLAAFMGTATEEIAVVIGPN
AGGLLNATFGNATELILAYIALKEGLIEVVKATLTGSIIGNLLLVMGFAVFLGGLRYKEQ
NFQPLAARLNASTMNLGVVAILLPTALQYTSTGVEETVLQNLSVAVAVVLIGVYLLSLVF
SMGTHAYLYDVGVAENMEMPELGEDVSEPEPPTEEEKPNLWLWTGVLLVVTLGVAVESEL
LVGSLEVATESLGLTALFTGVIVLPIIGNAAEHATAVTVAMKDKMDLSMSVVMGSSLQIA
FFVAPVLVIVGWAIGQPMDLNFNPFELVAVLVAVLIVNSISSDGTSNWLEGILLLATYAI
VALAFFFHPTLV
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtccaccaaaagtaagatttttcttgtcctgttagttttttgtcccctctcctttgcc
gcccactggttgggttggggggaaacgacggtgttcattttggctggtttggccattgtg
cccctagcagccttcatgggcacggccacggaggaaatcgccgtggtaatcggtcctaat
gcggggggcctgctcaatgccaccttcggcaacgccacagaactaattttggcctatatc
gccctaaaagaagggttaatcgaggtggtcaaagccaccctgacaggatcaattattggt
aacttactgctagtaatgggttttgccgtcttcctggggggattgcgctataaggaacaa
aatttccaacccctcgccgctcgcttgaatgcatccaccatgaatttgggggtagtggcg
attctgttacccacagccttgcaatacacctccacgggggtggaggaaacggttttacaa
aatctctctgtggccgtggccgtggtgttaatcggtgtctacctcctctccttggtgttt
tccatgggaacccatgcctatctgtacgatgtgggcgtggccgagaatatggagatgccc
gaactcggcgaagatgtatcagaaccggaacctcctacggaagaagaaaaacccaatctt
tggctttggacgggagttttattggtagtcaccctaggggtagcggtggaatcggaattg
ctggtgggttccttagaggtggccacggaatccctgggattaactgccctgttcaccggg
gtaatcgtcctacccattatcggtaacgctgccgagcacgccaccgccgtcactgtggcc
atgaaagataaaatggatctctccatgtctgtggtgatggggtcgagcctgcaaattgcc
ttctttgtggccccagtcttggtcatcgtcggctgggcgatcggtcagcccatggattta
aacttcaatccattcgagttggtagcggtattggtggcagttttgattgtcaactctatc
agtagtgatggcacttccaattggttagagggcatcctgttgcttgctacctatgccatt
gtggccctggcctttttctttcatcccaccctggtctag

DBGET integrated database retrieval system