KEGG   Synechocystis sp. PCC 6803: slr1356
Entry
slr1356           CDS       T00004                                 

Gene name
rps1
Definition
(GenBank) 30S ribosomal protein S1
  KO
K02945  small subunit ribosomal protein S1
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:syn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    slr1356 (rps1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:syn03011]
    slr1356 (rps1)
Ribosome [BR:syn03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    slr1356 (rps1)
SSDB
Motif
Pfam: S1
Other DBs
NCBI-ProteinID: BAA17570
CyanoBase: slr1356
CYORF: slr1356
UniProt: P73530
Position
1097077..1098063
AA seq 328 aa
MVSQTSTATIGFTLEDFAALLDKYDYHFSPGDIVAGTVFSMESRGALIDIGAKTAAYIPI
QEMSINRVDDPEEVLQPNETREFFILTDENEDGQLTLSIRRIEYMRAWERVRQLQAEDAT
VRSNVFATNRGGALVRIEGLRGFIPGSHISAREAKEDLVGEDLPLKFLEVDEERNRLVLS
HRRALVERKMNGLEVAQVVVGSVRGIKPYGAFIDIGGVSGLLHISEISHDHIDTPHSVFN
VNDEIKVMIIDLDAERGRISLSTKQLEPEPGAMLKDRDLVNEMADEMAEIFRQKRLAEAQ
GIPYEPPTSVDDTDDEEDESLAVSAVDE
NT seq 987 nt   +upstreamnt  +downstreamnt
atggtcagtcaaacttctacagcaactattggattcactctcgaggactttgccgccctt
cttgacaagtacgattatcactttagtcctggggacattgtcgctgggaccgtttttagc
atggagtcccggggggctctgattgacattggggcgaaaaccgccgcctacattcccatt
caggaaatgtcgatcaaccgtgtggatgaccctgaagaggtgctccagcccaatgaaacc
cgggaatttttcattctgaccgatgaaaacgaagatggtcagctcaccctctccatccgc
cggattgaatatatgcgggcttgggaacgggtcagacaactccaggcagaagatgccacg
gtgcgctccaatgtttttgccacaaaccgtggtggtgccttagtcagaattgaaggactg
cggggctttattcccggctcccacatcagcgctcgggaagcgaaagaggatctagtaggg
gaagatctgcccctgaagtttttggaagtggacgaagagcgtaatcgcctcgtgctcagc
caccgtcgggctctggtagagcggaagatgaacggtttagaagtggcccaggtagtggtg
ggttccgtccggggcatcaaaccctacggtgctttcatcgatatcggcggtgtcagcggt
ctgttgcacatttctgagatttcccacgaccacattgatactccccacagcgtcttcaat
gtcaatgatgaaatcaaggtgatgattattgacctggatgcggaacggggtcgtatttcc
ctttccaccaagcaattggagccagaacccggtgccatgctaaaagaccgggatttagtc
aacgaaatggcggacgaaatggcggaaattttccggcaaaaacgtttagcggaagcccag
ggcattccctatgagccccccacttccgttgatgacaccgatgatgaggaagatgagtcc
ctggctgtcagcgctgtggatgaataa

DBGET integrated database retrieval system