KEGG   Synechocystis sp. PCC 6803: slr1364
Entry
slr1364           CDS       T00004                                 

Gene name
bioB
Definition
(GenBank) biotin synthetase
  KO
K01012  biotin synthase [EC:2.8.1.6]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00780  Biotin metabolism
syn01100  Metabolic pathways
syn01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    slr1364 (bioB)
Enzymes [BR:syn01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.6  biotin synthase
     slr1364 (bioB)
SSDB
Motif
Pfam: Radical_SAM BATS TMP-TENI
Other DBs
NCBI-ProteinID: BAA17578
CyanoBase: slr1364
CYORF: slr1364
UniProt: P73538
Position
1107242..1108330
AA seq 362 aa
MVLASSRPPSPTNSPADRQGTLQAWLTGLSQRIIDGDRLTREEALQLAAIEGEENILLLC
EAANRIREACCGNVVDLCSIINVKSGNCSENCGFCSQSSHHPDPNSPIYGLKTEAEILEQ
ARAAAAAGAKRFCLVSQGRGPKYHSPKDREFEQILATVRQIIQETNIKPCCALGEVTPEQ
AQQLKEAGVTRYNHNLEASATYYDKIVSTHTWQDRVDTVKNLKAAGIQACTGGILGMGET
WEDRIDLALALRELEVESVPLNLLNPRPGTPLGEQQKLNPYDALKAIAIFRFILPQQIIR
YAGGREAVMGELQDLGLKAGINAMLVGHYLTTLGQPPERDQKLLASLGLEGGEAPIPGEY
QS
NT seq 1089 nt   +upstreamnt  +downstreamnt
gtggttctagcatcttcccgtcccccttcccccaccaattccccggccgatcgccagggg
actttgcaagcctggttaacaggtctcagtcagcgcattattgacggcgatcgcctaacc
cgggaagaagcattacagttggcggcgatcgagggggaagagaatattcttttgctctgt
gaagcagccaatcgcattcgggaagcctgctgtggcaatgtggtggatctgtgtagcatc
atcaatgttaaatccggtaactgctcggaaaactgcggcttttgctcccagtctagtcac
catcccgaccccaattcccccatttacggtctgaaaacggaagcagaaattttagaacag
gccagggcggcagcggcggcgggagctaaacgcttttgcttagttagtcagggtcggggc
cccaaataccatagccccaaggatcgagaatttgagcagatcctggccacagtgcggcaa
attatccaggaaaccaacatcaagccctgttgcgcgttgggggaagtgaccccggaacag
gcccagcaattgaaggaagctggggtgactcgttataaccataacttggaagcatccgct
acctattacgacaaaattgtcagcacccacacctggcaagaccgggtagatacggtgaaa
aaccttaaggcagcgggcattcaagcttgcactggcggcattttaggcatgggagaaacc
tgggaagaccgcattgatctagctttggctctgcgggaactggaagtggaatccgtgccc
ctgaatctactcaatccccgccccggtactcctttgggggaacaacaaaagttaaatccc
tacgatgccctcaaggcgatcgccattttccggtttattttgccccaacaaattattcgc
tatgctgggggccgggaagcggtgatgggagaattacaggatttagggctaaaagcgggc
attaacgctatgctagtgggccattatttaactaccctgggccagcctcccgaacgggat
caaaaattattggcatcccttggcctcgaagggggagaggcccctatccccggtgaatac
caatcctga

DBGET integrated database retrieval system