KEGG   Synechocystis sp. PCC 6803: slr1366
Entry
slr1366           CDS       T00004                                 

Gene name
lspA
Definition
(GenBank) lipoprotein signal peptidase
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn03060  Protein export
Brite
KEGG Orthology (KO) [BR:syn00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    slr1366 (lspA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:syn01002]
    slr1366 (lspA)
Enzymes [BR:syn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     slr1366 (lspA)
Peptidases and inhibitors [BR:syn01002]
 Aspartic peptidases
  Family A8: signal peptidase II family
   slr1366 (lspA)
SSDB
Motif
Pfam: Peptidase_A8
Other DBs
NCBI-ProteinID: BAA17580
CyanoBase: slr1366
CYORF: slr1366
UniProt: P73540
Position
1108967..1109452
AA seq 161 aa
MARSFSLAKNPLFWQVAIAGIILDQLSKLWVSQAMDPVGTTWPLWSGVFHFTYVLNTGAA
FSAFRGGAGWLKWLSLAVSVGLIIFAGKVPLRKLEQLGYGCILAGAVGNGIDRFLFGHVI
DFLDFRLINFPIFNLADVSINIGIAALLWASFFPVSSRKVD
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcccggtctttttccctcgctaaaaaccccctcttctggcaagtggcgatcgccggc
attatcctggatcagctcagtaaactttgggtgagtcaggccatggaccccgtgggcacc
acttggccgttgtggtctggagtgttccatttcacctatgtgctcaataccggggcagcg
ttcagtgcttttcggggcggggctggctggttaaaatggctttccctcgcagtaagcgtc
ggcctaattatctttgccggcaaagttcccctccgcaagttagaacagttgggttacggt
tgcattctagcgggggcggtgggcaatggcattgaccgttttttattcggtcatgtaatc
gactttttggattttcgcctgattaatttccccattttcaacctggccgatgtttccatt
aacattggcattgccgccctgctctgggccagttttttcccagtttcttcccgcaaggtt
gattaa

DBGET integrated database retrieval system