KEGG   Synechocystis sp. PCC 6803: slr1367
Entry
slr1367           CDS       T00004                                 

Gene name
glgP
Definition
(GenBank) glycogen phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00500  Starch and sucrose metabolism
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    slr1367 (glgP)
Enzymes [BR:syn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     slr1367 (glgP)
SSDB
Motif
Pfam: Phosphorylase
Other DBs
NCBI-ProteinID: BAA17586
CyanoBase: slr1367
CYORF: slr1367
UniProt: P73546
Position
1117107..1119674
AA seq 855 aa
MMSPRLFHQEQSMIDQSTLNTSPQPTITIEDDRTGMSVATLKRAFLDNLFYLQGIDRSQA
TLYDYYVALAYTIRDRLLHRFIKTVATYKQEKVKVVCYLSAEFLMGRHLGNNLINLGLYD
KIDQVMKEFDLDLNEIIEQEPDPGLGNGGLGRLAACFLDSLASLEVPAIGYGIRYEFGIF
HQRIQDGWQVEVPDNWLRFGNPWEIPRADESVEVKLGGHTEIIHNEKNQPKVVWIPERTI
LAIPYDTPVPGYQTNTVNPLRLWKAEASEEFNFEAFNSGLYDRAVAEKMDAETISKVLYP
NDNTPAGRELRLAQQYFFVSASLQDLIRIHLRTHPNLDTFYELTAIQLNDTHPAVAIAEL
MRLFVDRYDYDWDKAWDITQKTFAYTNHTLMPEALERWSVDLFAKLLPRHLEIIYEINHR
FLTGLQTWFPNDEALVESLSLIEENHGKKIRMANLACVGSHAINGVAALHTELLKKDTLR
DFAKLWPQKFFNKTNGVTPRRWILLSNPELSALVTEKIGDGWLKNLDEMRQIEKFVDDPE
FCRRWREIKQNNKRNLAAYLLKYRNVQIDVNSLFDVQVKRIHEYKRQHLAALEIIHLYNR
IKQNPHAEIVPRTFIFGGKAAPGYFMAKLIIKLINAVGEVVNNDPDVRGRLKVVFVSNFN
VSLGQRIYPAADLSEQISTAGKEASGTGNMKFAMNGALTIGTLDGANIEIREEAGPENFF
LFGLTAEQVYAMKENGYHPHTYYDNNFDLKAVIDRIAHGYFSPGNPNLFHPIVESLLHHD
PYMLLADYQAYVGCQDEVSKAYADQDRWTKMSILNSARMGKFSSDRTIREYCKEIWDVPP
VKISLDEYHPEYADL
NT seq 2568 nt   +upstreamnt  +downstreamnt
gtgatgtcaccccgactttttcatcaggaacaatcaatgattgatcaatctaccctaaac
acttcccctcaacccactatcacaattgaagatgaccgcaccggcatgagtgtggccact
ttgaagcgggcctttttggataaccttttttatctacaggggattgatcgttcccaggca
accctctacgactactacgttgccctggcctataccatccgcgatcgcctgttgcatcgt
ttcatcaagaccgtcgccacctataagcaggaaaaagtgaaggtggtttgttacctgtcg
gcggaattcctgatgggacggcatttaggcaataacctcattaacctggggttgtacgac
aaaatcgaccaggtaatgaaagaatttgacctggacttaaacgaaattattgagcaggaa
ccagaccccggcttgggcaatggtggcttaggccgtctagcggcctgtttcctcgattcc
cttgcttccctagaagtgccggcgatcggctacggcatccgctatgagtttggaattttt
caccagcgtattcaggacggttggcaggtggaagtgcccgacaactggttacggtttggt
aatccctgggaaatcccccgggctgatgagtcggtggaagtaaagctagggggccacacg
gagatcatccataacgaaaaaaatcaacccaaggtggtctggattcccgaaaggactatt
ctggccattccctacgacactccggtacctggttatcaaaccaatacggtcaatcccctc
cgactctggaaggcagaagctagtgaagaatttaactttgaagctttcaattctggtctg
tacgaccgggcagtagcggaaaagatggatgcggaaaccatttccaaggttctttatccc
aacgacaatacccccgctggccgagaattgcgcctagcccaacaatatttctttgtttct
gcttccctgcaggatctaattcggattcatctccgcacccaccctaatctcgatactttc
tacgaactcaccgccattcagttgaacgatacccaccccgccgtggcgatcgccgaattg
atgcgcctgtttgtggaccgttatgactacgactgggataaggcctgggacatcacccaa
aaaacctttgcctacaccaatcacaccctcatgccggaagccctagagcgctggtcagtg
gatttgtttgccaaactattgccccgtcatttggaaattatttacgagattaaccaccgc
ttcctaacggggttgcaaacctggttccccaacgacgaagctctggtggaaagcctttct
ttgattgaagaaaaccatggcaaaaaaattcgcatggccaacctggcctgtgtgggtagc
catgccatcaatggagtagccgccctccacaccgaactgctgaaaaaagataccctgcgg
gactttgccaagctctggccccagaagttctttaacaaaaccaatggcgttaccccccgc
cgctggattttgctcagcaaccctgaactatctgcgttggtaacggaaaaaattggcgat
ggttggctgaagaacctggatgaaatgcgacaaattgaaaagtttgttgatgatccggaa
ttttgtcgtcgctggcgagaaattaagcaaaataacaagcgtaacttagcggcctatttg
ctcaagtatcgcaatgttcagattgacgttaactccctgtttgatgtgcaggtcaaacgg
attcatgaatataagcgccaacacctagcggccctagaaattattcacctctataaccgc
atcaaacaaaatccccatgcggaaattgtgccccgtaccttcatttttgggggtaaggcc
gctccaggttatttcatggccaaattgattattaagttgatcaatgctgtgggggaggtg
gtcaacaacgatcccgatgtgcggggaaggctcaaagttgtctttgtctctaacttcaac
gtttccctggggcaaagaatttatcccgccgccgacttgtcggagcaaatttccaccgca
ggcaaggaagcctccggtacaggaaacatgaaattcgccatgaacggcgccctcaccatt
ggaaccctagatggggctaatatcgaaattcgggaagaggcagggccagaaaactttttc
ctctttggccttaccgctgaacaggtatatgccatgaaagaaaacggttaccatccccac
acctactatgacaataactttgatctaaaagctgtgattgaccgcattgcccacggctac
ttctcccccggtaaccccaatttgttccatcccattgtggagtcccttctgcaccacgat
ccctatatgctactggcggactaccaagcctatgtgggctgtcaggatgaagtcagcaaa
gcctacgccgaccaagaccggtggacaaaaatgtccattctcaactcggcccgcatgggt
aaattctcctccgatcgcaccattcgggaatactgcaaggaaatttgggatgtgcccccg
gtgaaaatttccctggatgaataccatcccgaatacgccgatttatag

DBGET integrated database retrieval system