KEGG   Synechocystis sp. PCC 6803: slr1438
Entry
slr1438           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Aldose_epim DUF4432
Other DBs
NCBI-ProteinID: BAA17544
CyanoBase: slr1438
CYORF: slr1438
UniProt: P73504
Structure
PDB: 
3K25

Position
1061242..1062111
AA seq 289 aa
MYNISFTPDRPLTYHLEDDQSLARLSLVPGRGGLVTEWTVQGQPILYFDRERFQDPSLSV
RGGIPILFPICGNLPQDQFNHAGKSYRLKQHGFARDLPWEVIGQQTQDNARLDLRLSHND
ATLEAFPFAFELVFSYQLQGHSLRIEQRIANLGDQRMPFSLGFHPYFFCREKLGITLAIP
ANDYLDQKTGDCHGYDGQLNLTSPELDLAFTQISQPRAHFIDPDRNLKIEVSFSELYQTL
VLWTVAGKDYLCLEPWSGPRNALNSGEQLAWVEPYSSRSAWVNFQVSTE
NT seq 870 nt   +upstreamnt  +downstreamnt
atgtacaacattagctttacccccgatcgcccgctgacctaccatttggaggatgatcaa
agtctggcccgtctttccctcgtgccggggcggggcggtctggtgaccgagtggaccgtt
caaggtcagcccatcctgtattttgaccgagagcggttccaggatccatccctgtcagta
cggggaggcatcccaattttgtttcccatttgtggcaatctgccccaggatcagttcaac
cacgccggtaaaagctatcgcctgaaacaacatggttttgcgcgggatctgccgtgggaa
gtaatcggccagcaaacccaagacaatgcccggttggatctacggttgagccacaatgat
gccaccctcgaagctttcccttttgcatttgagttggttttcagctatcaactccagggc
catagcctccgcattgaacaacgtattgccaaccttggcgatcagcggatgcccttttcc
ctcggtttccatccctattttttctgccgagagaagttagggattacgttagcaattcct
gccaatgattacctagaccaaaaaactggcgattgccatggctatgacgggcaactgaat
ctaacttccccggaattggatttagcctttacccaaatttcccagccaagggcccatttt
attgacccagaccggaatttaaagatagaagttagcttcagcgaactgtaccaaactctg
gtgttgtggactgtggctgggaaagattatctgtgcctcgagccttggagcgggcctcgc
aatgccctcaatagcggcgagcagttagcttgggtagaaccctattcttcccgttccgcc
tgggtaaattttcaggtgtccactgagtga

DBGET integrated database retrieval system