KEGG   Synechocystis sp. PCC 6803: slr1440
Entry
slr1440           CDS       T00004                                 

Definition
(GenBank) unknown protein
  KO
K06991  uncharacterized protein
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    slr1440
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_2
Other DBs
NCBI-ProteinID: BAA17548
CyanoBase: slr1440
CYORF: slr1440
UniProt: P73508
Position
1069178..1069609
AA seq 143 aa
MTGPVIFHLAIPVNDIAKTKEFYCDRLGAKAGRETDKAIILDFYGHQVVAHITLEPLVKQ
PGIYPRHFGLVFPVEADWFAFSEQVEAAGVPYHLPPKLRFAGELTEHRTFFLADPFHNYL
EFKWYRHQEAIFDLKEFLAIGDR
NT seq 432 nt   +upstreamnt  +downstreamnt
atgacaggccccgttatttttcacctcgctatccccgttaatgatattgcgaaaactaag
gaattttactgtgatcgcctgggggccaaggccggcagagaaaccgataaggcaataatt
ctagatttctacggccatcaggtggtggcccacattaccctggaacctttagtaaaacaa
ccgggcatctatccccgccattttggtttagtatttcctgtcgaagcggattggtttgct
ttttctgaacaggtggaagcggccggagtgccctatcatttgccgcccaagttacgcttt
gctggagaattgacggaacatcgcacttttttcctagctgaccccttccataactatctg
gaattcaaatggtatcgtcaccaggaagcaatttttgatctgaaagagtttctggccatt
ggcgatcgctag

DBGET integrated database retrieval system