KEGG   Synechocystis sp. PCC 6803: slr1441Help
Entry
slr1441           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDDEXK_10 NERD AHJR-like DUF4143 HSDR_N_2 7TM_GPCR_Srj DUF3883
Motif
Other DBs
NCBI-ProteinID: BAA17552
CyanoBase: slr1441
CYORF: slr1441
UniProt: P73512
Position
1076065..1076454
Genome map
AA seq 129 aa AA seqDB search
MESQVRPAAVRLFREWGIDVQEISSDVSLQTSQDGIEIDILVVNGTEAIAIEVKSKLSQD
DVDEHLERLGKFKRLLPRYQNFNLLGAVAAMVIPGDVARYAYKKGLFVIAQSGEDLVILN
DEKFKPKAW
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
gtggaatcccaggtgcggccggcggcggtgcgattatttcgagaatggggcattgatgtc
caagaaatttcctctgatgtatctcttcagaccagtcaagatggcattgaaattgatatt
ttggtggtgaatggcacagaggcgatcgccattgaggtgaaaagtaaattaagccaggat
gatgtggatgaacacctggaaagattgggtaaatttaagcgacttttgccccgttatcaa
aattttaatcttcttggggcagtggcagccatggttattccgggtgatgtggctcgctat
gcctataaaaaagggttatttgtaattgcccaatcgggggaagatttggtcattcttaat
gatgagaaatttaaacccaaggcctggtaa

DBGET integrated database retrieval system