KEGG   Synechocystis sp. PCC 6803: slr1442
Entry
slr1442           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: NQR2_RnfD_RnfE
Other DBs
NCBI-ProteinID: BAA17554
CyanoBase: slr1442
CYORF: slr1442
UniProt: P73514
Position
1077755..1078612
AA seq 285 aa
MLTVHRDARDYQIIFLCSFLSLGILARDWSLSPLVIAVVLATALTVQSLFTINQQGNFSR
WFSLDTWQSLWRHQGWKSALITGLGLCLLLRANHLSTLILAASLAIASKFLLQAWGKHWF
NPANFGIIAALTLTGDAWVSPGQWGTTLWLGAVFLAAGGLVLGKVGRWDTSIMFLAVYAG
LDLARNAWLGWPPEVSFHHLENGSLLVFALFMLTDPRSIPNARSSRLIWATAIAIFSLIL
QYHFYLPTALFWALFCLSPLTVLLDRQFPAPRFQWWQKKNPVPSN
NT seq 858 nt   +upstreamnt  +downstreamnt
atgctgactgtccaccgtgatgcccgggattaccagattatttttctctgtagctttttg
agtttggggatattggcccgggactggagtttaagccccctggtgatcgccgttgttttg
gccactgccctgacagtgcaatccttattcaccattaatcaacagggcaattttagtcgg
tggttttccctcgatacctggcagagtttatggagacatcaaggttggaaaagtgctttg
attactggcttaggtctttgtctattactccgagccaaccatttatccactttgatattg
gcggctagtttggcgatcgccagcaaatttttgttgcaagcctggggtaaacattggttt
aatccggctaacttcggcattattgccgctctgactttaacgggggatgcgtgggtttcc
cctggacaatggggcacgactctctggttgggagcagttttcctggctgcggggggtttg
gtgttgggtaaagtgggacgatgggacacatcaataatgtttttggcggtttatgccggg
ttggatttagcccgcaacgcttggttaggttggccgccggaagttagtttccatcatttg
gaaaatggcagtttactggtgtttgccctgtttatgctcaccgatccccgctccattccc
aatgcccgctctagtcgtttaatctgggctacggcgatcgccatttttagcctaattttg
caatatcacttctacttgcccactgctttgttctgggccttgttttgtctttcgcccctg
accgtattgctagaccgtcagtttcccgcccctcgttttcaatggtggcagaagaagaac
cctgtaccgtcaaattaa

DBGET integrated database retrieval system