KEGG   Synechocystis sp. PCC 6803: slr1443
Entry
slr1443           CDS       T00004                                 

Gene name
pknA
Definition
(GenBank) protein kinase
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:syn01001]
    slr1443 (pknA)
Enzymes [BR:syn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     slr1443 (pknA)
Protein kinases [BR:syn01001]
 Serine/threonine kinases: Other
  Bacterial family
   slr1443 (pknA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-ProteinID: BAA17555
CyanoBase: slr1443
CYORF: slr1443
UniProt: P73515
Position
1078657..1080501
AA seq 614 aa
MTPSLSLGQRLDDRYLIQLHLGQNSLGQQYLAQDTHRFDEPCTITVLTAPPGDKAGNLFK
QQAEILYALDHPQIANFREFFALGSELYLVQDFIEGQSYFDLLKDRRLQGKAFTELEVRQ
WCRQLLPVLHYLHIQKICHGQISPSSIMRRTVDGLPVLVDFTHSQYYSGTPGEDRRDLHG
LGLGAIALLTGEVNPNPPWENLLSSVALSQEFRQLLLKLLAWPPLVDWPTLTDNLNNLPQ
HFLPTVAEFNLTSTIPEQTDNGVGKSSTGEPPFPTVHQSPESSSSAKVKNMVRVDGLKGL
VKKSFILLGLMAIAMALGWGAGQLWLDNQQRAALEKLAQEEPGDDVPEKTDLEIKNEIRA
RRLNLGISPQRFQTLMDDGLAFQLGIDPQQRLEKNPNTNGAPLSLGSPEQQMAMTITVLD
ALESLSREATRDFAQNNSGDRRRWIPRVNQLRLSSRSFYDLVNARFHHYLPMVSPALLGE
PEFEQRPLAQVWNAMAFDSLASLEDESHYQRLSFDDTNQLNLNGTLEPGEGYAYAVTIPP
TEEFSLQLTAPPTARISFYPPTGPEVILQNSAMHRWSGPTDQAGYYELVITSVAEEPIAF
ELELSIIPASAQPF
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgaccccatccttgtccctgggccaacgcctcgatgaccgttacctgattcaactgcat
ttaggacaaaattccctgggtcagcagtatctggcccaagatacccaccgctttgatgaa
ccctgcaccatcacggttttaactgcgccccccggggacaaagccggcaatttgtttaag
caacaggcggaaatactctacgccctcgaccatccccaaattgctaatttccgggagttt
tttgccctggggtcagagctttatctagtacaggattttatcgaaggacaatcctatttc
gatttgctcaaagaccgccgccttcaggggaaagcttttacggaattggaagtacgccaa
tggtgccgtcaactgctaccggttttacactatctccacatccagaaaatttgccatggc
cagattagccccagtagtataatgcgccgtacagtggatgggctgccagtgttggtagat
tttactcatagtcaatattattccggtactccaggggaagaccgacgagatttacatggt
ctaggcctgggggcgatcgccttgctgacgggggaagttaaccctaacccaccttgggaa
aacctgttgtcctccgttgccctcagtcaggaatttcgccagttattgctgaaattacta
gcttggccgcccctggtggattggcctactttgacggacaatctgaacaacttgccccag
cattttttgcctacagtggctgagtttaacctgacgtccaccataccagagcaaactgat
aatggcgttggtaaatctagcaccggggaaccccctttccccacagtccatcagtctcct
gaatcttcttcttccgcaaaagtaaaaaatatggtccgagtcgatgggttaaaggggcta
gtcaaaaaatcattcatcttactgggcttgatggcgatcgccatggccctaggctgggga
gcagggcagttatggctagataatcaacaacgggcggcgttggagaaattggcacaggaa
gaaccgggggatgatgtgccggaaaaaaccgatttggagattaaaaatgaaattcgggcc
cgccgactaaatttaggcatttctccccaacgatttcagaccttgatggacgatggttta
gcttttcagttgggtattgacccccagcaaaggttggaaaagaaccccaataccaatggt
gcccctctgagcctcggctccccagagcaacagatggccatgaccatcactgtgttggat
gccttggaaagtttgagtcgagaagctacgagggattttgcccaaaacaattccggcgat
cgccgccgctggattccgagggtaaatcaattgcgcctcagcagtcgtagtttttacgat
ttggtcaatgcccgtttccatcactatttacccatggtcagccctgctttattgggggaa
ccggaatttgagcaacgccccctggcccaggtatggaatgccatggcctttgacagcttg
gcaagcctggaggatgaaagccattaccaaagactgagttttgacgataccaatcagctc
aacctcaatggcaccctggagccaggagaaggctatgcctatgctgttaccattcccccc
acagaggagttcagcctacaattaaccgcccctcccaccgctcgaatttccttctatccc
cccaccgggccggaggtaattctgcaaaattctgccatgcaccgctggtctggccccact
gaccaagccggttattacgagttggtaatcacatcggtagcggaggagccgatcgccttt
gaactggaactcagtatcattcccgccagtgctcaaccattttga

DBGET integrated database retrieval system