KEGG   Synechocystis sp. PCC 6803: slr1444
Entry
slr1444           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: CHAD
Other DBs
NCBI-ProteinID: BAA17556
CyanoBase: slr1444
CYORF: slr1444
UniProt: P73516
Position
1080695..1081696
AA seq 333 aa
METTHSFGDRAVFAFGKHTGKIFKYAPRVLKDQDPEDLHQLRVGVRRLRTAVIGFMPAVQ
LPQGITERKIGKIGQQLGVQRDNDVLQEILLHKYLPHLPTSEQGCLEKVLKRLQKERKQA
FKATYKLLTHDKFTQFKQSWEIWLEHPHFTSLGGLAIADVLPDLLLPQLSQFFLHPGWLV
GTEIDPDTNSSNRQRRCIDLSPTAIETLLDGEESILHDLRKEAKRTRYQMELFSDYFGEE
YQQLLAQVKMTQEILGNLQDSFVLRAMVEQYLDVDLKQLCPQWSAIFHGDRLGYWDQWQP
LQSQFIDPVYRHHCRQLVQNPLVNSDQPTSSNL
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggaaacaacacatagctttggcgatcgagcagttttcgccttcgggaaacacactgga
aaaatttttaaatatgcccctagggttttaaaagatcaagacccagaggatctgcatcag
ttgcgggtgggggtacgacggttaagaacggcggtcattggttttatgccagccgtgcaa
ttaccccagggcattacggaaagaaaaatcggaaaaataggtcaacagttgggagtgcaa
cgggacaatgatgttttgcaggaaattttgctccataaatatttaccccatttaccaaca
tcggaacaaggttgtttggaaaaagttttaaaacgtttacaaaaggagcgaaaacaggcg
tttaaagccacctataaattgttaacccacgacaaatttactcaatttaaacagagctgg
gaaatatggctagaacatccccacttcactagcctcggtggtttggcgatcgccgatgta
ttacctgatttacttctgccccaactgagccaattttttcttcatcccggttggttggtt
ggtacagaaattgaccccgatactaacagttcaaaccgacaacgtcgctgtattgacctc
agtcctaccgccattgaaactttgttagacggggaagaatcaattttgcacgatttacgt
aaagaagcaaaacgcacccgctaccaaatggagctatttagcgattactttggggaagaa
tatcaacaattattagcccaggtaaaaatgacccaagaaatcctcggcaatttgcaagat
agcttcgttttgagggccatggtggagcagtacctggatgtagacctaaagcaactctgt
ccccaatggagtgctattttccatggcgatcgcctgggatattgggaccaatggcaacca
ttgcagagccagtttatcgaccccgtatatcgtcaccactgtcgtcaactggtgcaaaat
ccccttgtaaacagtgaccagccaacttctagcaacctttaa

DBGET integrated database retrieval system