KEGG   Synechocystis sp. PCC 6803: slr1448
Entry
slr1448           CDS       T00004                                 

Gene name
cscK
Definition
(GenBank) fructokinase
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00051  Fructose and mannose metabolism
syn00500  Starch and sucrose metabolism
syn00520  Amino sugar and nucleotide sugar metabolism
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    slr1448 (cscK)
   00500 Starch and sucrose metabolism
    slr1448 (cscK)
   00520 Amino sugar and nucleotide sugar metabolism
    slr1448 (cscK)
Enzymes [BR:syn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     slr1448 (cscK)
SSDB
Motif
Pfam: PfkB DUF4434
Other DBs
NCBI-ProteinID: BAA17561
CyanoBase: slr1448
CYORF: slr1448
UniProt: P73521
Position
1089400..1090323
AA seq 307 aa
MAEVVCFGEMLFDCLADQLGVPLEQVKSWTNYAGGAPANVACALVKQGVSAAFVGRLGAD
QAGQELKNVLQQCQVNTDGLQIDPHRPTRLVYVTRTGDGDRHFAGFGEYHTGDFADTAMQ
GETIPESLFTSAQYLVMGTIALAYAPSRTATERLVALAKKHQVKIFLDVNWRSVFWDDEA
QAKERIPALITHAQILKCTDEEAVWLFGHQDPVTIHQKLPHLQGVLVTAGDKGCSYSLGK
NHGEVPAFKVNVRDTTGAGDSFVAGFLAQALTHGENLFIDPHLSCQAVTYASAIGALTTL
HPGAIAR
NT seq 924 nt   +upstreamnt  +downstreamnt
atggctgaggttgtctgttttggagaaatgctcttcgactgtttggcagaccagttggga
gtccccttggaacaagttaaatcctggactaactacgccggtggtgcccctgccaatgtg
gcctgtgccctagtcaaacaaggtgttagcgccgcttttgttggtcgtttgggggcagac
caggccggacaagaacttaaaaatgttctacagcaatgtcaagttaataccgatgggctc
caaatcgatccccaccggcccacccgtttggtttatgtgacccggacaggggacggcgat
cgccattttgctgggtttggggaatatcacaccggggattttgccgacacagcgatgcag
ggagaaaccattcccgaatccctattcacctcagctcaatatttggtgatgggcaccatt
gccctggcctatgcccccagtcgcactgccacggagcggttagtggcattggcgaaaaag
caccaggtaaaaatatttttagatgtcaactggcgatcggttttttgggacgatgaagca
caggcaaaggaaagaattcccgccctgattacccatgcccaaattttaaaatgtaccgac
gaggaagcagtgtggctgtttggtcaccaagatccggtcaccatccaccagaaactaccc
cacctccagggagtattggtcaccgccggggacaagggttgttcctactccttaggcaaa
aaccatggggaagtccctgcttttaaagttaatgtgcgggatactaccggggctggggac
agttttgtggccggatttttggcccaggccctgacccacggagagaatttattcatagac
cctcatctcagttgccaggcagtgacctatgccagtgccataggagccttgaccactctc
cacccaggggcgatcgccagatag

DBGET integrated database retrieval system